DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL14 and MRPL14

Sequence 1:NP_001259186.1 Gene:mRpL14 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001305699.1 Gene:MRPL14 HGNCID:14279 Length:198 Species:Homo sapiens

Alignment Length:131 Identity:68/132 (52%)
Similarity:87/132 (66%) Gaps:10/132 (8%)


  Fly    31 TTPACCEIRKLARLRVVDNSDLGKKAMAEGRPPRCIHVYNKRGVGFIGDKVLVAIKGQMKKGILV 95
            ||.:...|:|:.|:||||||.||....  .|.|||||||.|.|||.:||::|:|||||.||.::|
Human    78 TTGSLSAIQKMTRVRVVDNSALGNSPY--HRAPRCIHVYKKNGVGKVGDQILLAIKGQKKKALIV 140

  Fly    96 GLKQNQKPKQPKFDSNNLVLIDDNGSPLGTRIHVPIPTILRTILKEKTLAKGADYTKVLAIASRY 160
            |.........|:|||||:|||:|||:|:||||..||||.||        .:..:|:||||||..:
Human   141 GHCMPGPRMTPRFDSNNVVLIEDNGNPVGTRIKTPIPTSLR--------KREGEYSKVLAIAQNF 197

  Fly   161 V 161
            |
Human   198 V 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL14NP_001259186.1 Ribosomal_L14 38..159 CDD:294234 65/121 (54%)
MRPL14NP_001305699.1 Ribosomal_L14 85..195 CDD:294234 65/120 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C180298366
eggNOG 1 0.900 E1_KOG3441
Hieranoid 1 1.000
Homologene 1 1.000 H12268
Inparanoid 1 1.050 126 1.000 Inparanoid score I4630
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1547267at2759
OrthoFinder 1 1.000 FOG0007877
OrthoInspector 1 1.000 T1075536
orthoMCL 1 0.900 OOG5_134120
Panther 1 1.100 LDO PTHR21037
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3812
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.