DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL14 and mrpl14

Sequence 1:NP_001259186.1 Gene:mRpL14 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_957441.1 Gene:mrpl14 ZFINID:ZDB-GENE-040426-1066 Length:141 Species:Danio rerio

Alignment Length:151 Identity:74/152 (49%)
Similarity:96/152 (63%) Gaps:15/152 (10%)


  Fly    16 LAVTLGG-----QQTQQLIHTTPACCEIRKLARLRVVDNSDLGKKAMAEGRPPRCIHVYNKRGVG 75
            :|::|.|     ...|:....:.|...|:||.|:||||||.||.  ....|||:.||||||.|||
Zfish     1 MALSLSGLILPKLMQQRAFSVSSAVSAIQKLTRVRVVDNSTLGN--AHHHRPPKVIHVYNKNGVG 63

  Fly    76 FIGDKVLVAIKGQMKKGILVGLKQNQKPKQPKFDSNNLVLIDDNGSPLGTRIHVPIPTILRTILK 140
            .:||:||:|||||.||.|:||.|.......|:|||||:|||:|||:|.||||..|:||.||.:  
Zfish    64 KVGDRVLLAIKGQKKKAIIVGHKMPGARMTPRFDSNNVVLIEDNGNPTGTRIKAPLPTHLRKL-- 126

  Fly   141 EKTLAKGADYTKVLAIASRYV 161
                  ..:|:|:||||.|:|
Zfish   127 ------EGEYSKLLAIAQRFV 141

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL14NP_001259186.1 Ribosomal_L14 38..159 CDD:294234 67/121 (55%)
mrpl14NP_957441.1 Ribosomal_L14 28..140 CDD:294234 68/122 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C180299081
eggNOG 1 0.900 E1_KOG3441
Hieranoid 1 1.000
Homologene 1 1.000 H12268
Inparanoid 1 1.050 130 1.000 Inparanoid score I4540
OMA 1 1.010
OrthoDB 1 1.010 D1547267at2759
OrthoFinder 1 1.000 FOG0007877
OrthoInspector 1 1.000 T1054767
orthoMCL 1 0.900 OOG5_134120
Panther 1 1.100 LDO PTHR21037
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3812
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.