DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL14 and Mrpl14

Sequence 1:NP_001259186.1 Gene:mRpL14 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_008765071.1 Gene:Mrpl14 RGDID:1306240 Length:155 Species:Rattus norvegicus

Alignment Length:156 Identity:75/157 (48%)
Similarity:100/157 (64%) Gaps:19/157 (12%)


  Fly    15 PLAVTLG---------GQQTQQLIHTTPACCEIRKLARLRVVDNSDLGKKAMAEGRPPRCIHVYN 70
            |:||..|         |..:|:...|:.:...|:|:.|:||||||.||....  .||||||||||
  Rat    10 PMAVLTGLFGFFAYVRGAVSQRCFSTSGSLSAIQKMTRVRVVDNSALGNTPY--HRPPRCIHVYN 72

  Fly    71 KRGVGFIGDKVLVAIKGQMKKGILVGLKQNQKPKQPKFDSNNLVLIDDNGSPLGTRIHVPIPTIL 135
            |.|||.:||::|:||:||.||.::||.:.......|||||||:|||:|||:|:||||.:||||.|
  Rat    73 KSGVGKVGDQILLAIRGQKKKALIVGHRMPGSRMTPKFDSNNVVLIEDNGNPVGTRIKIPIPTSL 137

  Fly   136 RTILKEKTLAKGADYTKVLAIASRYV 161
            |        .:..:|:||||||..:|
  Rat   138 R--------RREGEYSKVLAIAQNFV 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL14NP_001259186.1 Ribosomal_L14 38..159 CDD:294234 67/121 (55%)
Mrpl14XP_008765071.1 Ribosomal_L14 42..152 CDD:294234 67/120 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C180300097
eggNOG 1 0.900 E1_KOG3441
Hieranoid 1 1.000
Homologene 1 1.000 H12268
Inparanoid 1 1.050 135 1.000 Inparanoid score I4406
OMA 1 1.010
OrthoDB 1 1.010 D1547267at2759
OrthoFinder 1 1.000 FOG0007877
OrthoInspector 1 1.000 T1089187
orthoMCL 1 0.900 OOG5_134120
Panther 1 1.100 LDO PTHR21037
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.