DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL14 and mrpl38

Sequence 1:NP_001259186.1 Gene:mRpL14 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_596481.2 Gene:mrpl38 PomBaseID:SPBC887.07 Length:136 Species:Schizosaccharomyces pombe

Alignment Length:137 Identity:39/138 (28%)
Similarity:62/138 (45%) Gaps:37/138 (27%)


  Fly    44 LRVVDNSDLGKKAMAEGRPPRCIHVYNKRGVGFIGDKVLVAIK-----------GQMKKG----- 92
            |:|:|||.   ..:||     ||.|........:||:|:|.:|           .::|:|     
pombe    18 LKVIDNSG---ATLAE-----CIRVVRAGKFASLGDEVVVVVKKARSGSSVTAANKVKRGDIHHA 74

  Fly    93 ILVGLKQN-QKP--KQPKFDSNNLVLIDDNGSPLGTRIHVPIPTILRTILKEKTLAKGADYTKVL 154
            |:|..|.. ::|  :..:||.|..||::....||||||...:...|||          ..:||:.
pombe    75 IIVRTKSPVRRPDGRYVRFDDNACVLVNKECEPLGTRILSVVANELRT----------KHHTKIA 129

  Fly   155 AIASRYV 161
            ::|.|.:
pombe   130 SLAPRTI 136

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL14NP_001259186.1 Ribosomal_L14 38..159 CDD:294234 38/134 (28%)
mrpl38NP_596481.2 Ribosomal_L14 12..134 CDD:278659 38/134 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.