DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL14 and F45E12.5

DIOPT Version :10

Sequence 1:NP_525048.1 Gene:mRpL14 / 31222 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_495528.1 Gene:F45E12.5 / 185803 WormBaseID:WBGene00018475 Length:197 Species:Caenorhabditis elegans


Alignment Length:70 Identity:15/70 - (21%)
Similarity:27/70 - (38%) Gaps:19/70 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VVDNSDLGKKAMAEGRPP-----------RCIHV-----YNKRGVGFIGDKV---LVAIKGQMKK 91
            ::.|..|.:.|:.:.:.|           |.||:     .|.|.:.:|..|.   :..|...::|
 Worm    99 MIANYTLFEAAINKSKVPWVNYDGLTSEERTIHMAHTRAINDRKLTYIDPKTGYSVFTISHHLQK 163

  Fly    92 GILVG 96
            |...|
 Worm   164 GKCCG 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL14NP_525048.1 Ribosomal_uL14 39..136 CDD:466774 15/70 (21%)
F45E12.5NP_495528.1 DUF5522 133..180 CDD:435947 8/36 (22%)

Return to query results.
Submit another query.