DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL14 and mrpl-14

Sequence 1:NP_001259186.1 Gene:mRpL14 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_495528.1 Gene:mrpl-14 WormBaseID:WBGene00018475 Length:197 Species:Caenorhabditis elegans

Alignment Length:70 Identity:15/71 (21%)
Similarity:27/71 (38%) Gaps:19/71 (27%)


  Fly    46 VVDNSDLGKKAMAEGRPP-----------RCIHV-----YNKRGVGFIGDKV---LVAIKGQMKK 91
            ::.|..|.:.|:.:.:.|           |.||:     .|.|.:.:|..|.   :..|...::|
 Worm    99 MIANYTLFEAAINKSKVPWVNYDGLTSEERTIHMAHTRAINDRKLTYIDPKTGYSVFTISHHLQK 163

  Fly    92 GILVG 96
            |...|
 Worm   164 GKCCG 168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL14NP_001259186.1 Ribosomal_L14 38..159 CDD:294234 15/71 (21%)
mrpl-14NP_495528.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3812
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.