DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL14 and mrpl14

Sequence 1:NP_001259186.1 Gene:mRpL14 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001165105.1 Gene:mrpl14 XenbaseID:XB-GENE-970368 Length:144 Species:Xenopus tropicalis

Alignment Length:137 Identity:71/138 (51%)
Similarity:92/138 (67%) Gaps:10/138 (7%)


  Fly    25 TQQLIHTTPACCEIRKLARLRVVDNSDLGKKAMAEGRPPRCIHVYNKRGVGFIGDKVLVAIKGQM 89
            |.|.:..:..|..|:||.|:||||||.||  :....|||:|||||||.|||.:||::|:|||||.
 Frog    18 TIQHLSLSAPCGAIQKLTRVRVVDNSTLG--STPYHRPPKCIHVYNKSGVGKVGDRILLAIKGQK 80

  Fly    90 KKGILVGLKQNQKPKQPKFDSNNLVLIDDNGSPLGTRIHVPIPTILRTILKEKTLAKGADYTKVL 154
            ||.::||.|.......|:|||||:|||:|||:|:||||..||||.||        ....:::|||
 Frog    81 KKALIVGHKMPGASMTPRFDSNNVVLIEDNGNPVGTRIKTPIPTSLR--------RHDGEFSKVL 137

  Fly   155 AIASRYV 161
            |||..:|
 Frog   138 AIAQNFV 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL14NP_001259186.1 Ribosomal_L14 38..159 CDD:294234 67/121 (55%)
mrpl14NP_001165105.1 Ribosomal_L14 31..141 CDD:294234 67/120 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C180297905
eggNOG 1 0.900 E1_KOG3441
Hieranoid 1 1.000
Homologene 1 1.000 H12268
Inparanoid 1 1.050 133 1.000 Inparanoid score I4354
OMA 1 1.010
OrthoDB 1 1.010 D1547267at2759
OrthoFinder 1 1.000 FOG0007877
OrthoInspector 1 1.000 T602201
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3812
TreeFam 1 0.960
1110.890

Return to query results.
Submit another query.