DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14050 and LOC100334312

DIOPT Version :8

Sequence 1:NP_001245487.1 Gene:CG14050 / 31218 FlyBaseID:FBgn0040392 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_009300940.1 Gene:LOC100334312 / 100334312 -ID:- Length:583 Species:Danio rerio

Alignment Length:167 Identity:36/168 (21%)
Similarity:55/168 (33%) Gaps:42/168 (25%)


  Fly    55 LDEKREIRAALAQQQANKDAVNPTKKVLASKYPLYPTTRKQSFITEDDDSQHSGMETMVTLNGEE 119
            :::.:.....||.||..........|....|.....|..|:..:|...|:..:.:........||
Zfish   136 VEKSKPAHILLALQQVGHPHTAQAIKACVDKCMQEWTIPKEKILTVITDNGSNMVAAFKNTTAEE 200

  Fly   120 TGDVDNKNNATVSQFEGVFIGKSEIPDEEYQWKNSANMELKAVDVSVAQTTNESSVCVAPT---- 180
            |...|:...:|:.       ..|||.|:.|:   ..:|||            :.:.||..|    
Zfish   201 TSSEDDSPGSTIE-------SDSEIDDQRYR---HVDMEL------------DRTPCVVHTIQLV 243

  Fly   181 -------STTARAKSPARAA------SSAAA---LDQ 201
                   :|..|....||:.      ||.|.   |||
Zfish   244 VHMLQKETTVKRVLDKARSVVKLFRKSSVATQKLLDQ 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14050NP_001245487.1 zf-BED 7..47 CDD:295438
LOC100334312XP_009300940.1 DUF659 <152..263 CDD:282753 26/133 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005415
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.