DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14050 and si:dkey-13n23.3

DIOPT Version :8

Sequence 1:NP_001245487.1 Gene:CG14050 / 31218 FlyBaseID:FBgn0040392 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_001340716.5 Gene:si:dkey-13n23.3 / 100000534 ZFINID:ZDB-GENE-120214-42 Length:650 Species:Danio rerio

Alignment Length:159 Identity:35/160 (22%)
Similarity:62/160 (39%) Gaps:33/160 (21%)


  Fly     1 MSKKYPNPVTKHFVYSERTRKSTCKRCHFDMAGRHSENLMRHLKRKHEDAYKSVL---------D 56
            :.:|....:..:|.|..:..||.||.|...:||:::.||.|||:..|.:.:..:.         .
Zfish    12 LGRKRRIDIWSNFTYDNKDNKSVCKPCGVKIAGKNTTNLKRHLQTAHPEIHTKIQKMSDDHGPGG 76

  Fly    57 EKREIRAALAQQQANKDAVNPTKKVLASKYPLYPTTRKQSFITEDDDSQHSGME--TMVTLNGEE 119
            .|.....:..||||..|.:..:|         |.|..|:....|...::..|..  .:.|:..|:
Zfish    77 NKASDATSTTQQQAISDFLRSSK---------YKTESKEQQTKEQAIARWIGRTGLPLTTVEDED 132

  Fly   120 ----TGDVDNK---------NNATVSQFE 135
                .|.:|.:         :|...:|:|
Zfish   133 FVLMMGMIDGRLTVPKKTKISNLIETQYE 161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14050NP_001245487.1 zf-BED 7..47 CDD:295438 14/40 (35%)
si:dkey-13n23.3XP_001340716.5 ZnF_BED 19..61 CDD:214746 15/42 (36%)
DUF659 <219..330 CDD:309874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005415
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.