DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2865 and SERTAD4

DIOPT Version :9

Sequence 1:NP_001259184.1 Gene:CG2865 / 31217 FlyBaseID:FBgn0023526 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001362357.1 Gene:SERTAD4 / 56256 HGNCID:25236 Length:356 Species:Homo sapiens


Alignment Length:335 Identity:73/335 - (21%)
Similarity:112/335 - (33%) Gaps:117/335 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DSDMFGPPR--------------CSPPIGYHHHR--------SRVPMISPKLRQREERKRILQLC 77
            ::|.:|.|.              ..||:...|:|        |::.....|..:.|:....|..|
Human    30 EADSYGGPSPPGPAQAPLQGDRGAGPPLAGSHYRGISNPITTSKITYFKRKYVEEEDFHPPLSSC 94

  Fly    78 AHK---------------MERIK---DSEANLRRSVCINNTYCRLNDELRREKQMRYLQN---LP 121
            :||               :|::|   |.|..|||||.|||...|::.|:       .:||   .|
Human    95 SHKTISIFEERAHILYMSLEKLKFIDDPEVYLRRSVLINNLMKRIHGEI-------IMQNNWCFP 152

  Fly   122 RTSDSGASTE---LARENLFQPNMDDAK-------------PAGNSTSN---NINAN-GKPSSSF 166
            ..|.:|.|.:   :|::..::.....||             ..|....|   ::||| |..|::.
Human   153 ACSFNGTSAQEWFMAQDCPYRKRPRMAKEECEKFHACCFYQECGGHYLNLPLSVNANVGSASTAA 217

  Fly   167 GDAFGSSNGSSSGRGGICSLENQPPERQQLGTPAGASAPEAANSAPLSVSGSASERVNNRKRHLS 231
            .....||:.|||        .:.||          ...|..:......| ||||           
Human   218 SSPSASSSSSSS--------SSSPP----------LPLPSCSRQVDFDV-GSAS----------- 252

  Fly   232 SCNLVNDLEILDRELSAINAPMLLIDPEITQGAEQLEKAALSASRKRLRSNS-----GSEDESDR 291
              ...:|.:|...|:...|...|.:.          |||.|:..:....:|.     ..|...:.
Human   253 --IYKSDGQIPANEIFVTNVRSLGVQ----------EKAKLNDEKANDDTNRDGGPLSHEPVGND 305

  Fly   292 LVREALSQFY 301
            |..|...|||
Human   306 LAFECKGQFY 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2865NP_001259184.1 SERTA 73..109 CDD:283648 18/53 (34%)
SERTAD4NP_001362357.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..53 2/19 (11%)
SERTA 108..142 CDD:368713 13/33 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 215..238 7/40 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..302 3/21 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 332..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159000
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E2MX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.