DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2865 and Sertad4

DIOPT Version :9

Sequence 1:NP_001259184.1 Gene:CG2865 / 31217 FlyBaseID:FBgn0023526 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_017175228.1 Gene:Sertad4 / 214791 MGIID:2443496 Length:439 Species:Mus musculus


Alignment Length:294 Identity:71/294 - (24%)
Similarity:111/294 - (37%) Gaps:65/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EDSDMFGPPRCSPPIGYHHHRSRVPMISPKLRQREERKRILQLCAHKMERIKDSEANLRRSVCIN 98
            ||.|:      .||:....|::        :...|||..||.:...|:..|.|.|..|||||.||
Mouse   145 EDEDL------HPPLSSCSHKT--------ISIFEERAHILYMSLEKLRFIDDPEVYLRRSVLIN 195

  Fly    99 NTYCRLNDELRREKQMRYLQN---LPRTSDSGASTE---LARENLFQPNMDDAKP---------- 147
            |...|::.|:       .:||   ||..|..|...:   ||::..::.....||.          
Mouse   196 NLMKRIHGEI-------VMQNSWCLPACSLGGTPAQEWFLAQDCPYRKRPRVAKEEWEKIHTCCF 253

  Fly   148 ----AGNSTSNNINANGKPSSSFGDAFGSSNGSSSGRGGICSLENQPPERQQLGTPAGASAPEAA 208
                .|:..:..::.|....|:...|..|:..|||.           |......:|:.:|:|   
Mouse   254 YQECGGHCLNLPLSVNTSVGSTSAAAVASAASSSSS-----------PSTSSSSSPSSSSSP--- 304

  Fly   209 NSAPLSVSGSASERVNNRKRHLSSCNLVNDLEILDREL--SAINAPMLLIDPEITQGAEQLEK-- 269
            :.:|.|.|.|:|    :....|.||:...|.:|....:  |.|.|..:.:....:.|.::..|  
Mouse   305 SPSPSSSSSSSS----SSPLPLPSCSHHVDFDIGSAPIYKSQIPASEIFVTNIRSLGVQEKVKFN 365

  Fly   270 --AALSASRKRLRSNSGSEDESDRLVREALSQFY 301
              ..:|....|.....|.|...:.|..|...|||
Mouse   366 NDGKVSHETSRDGDALGQEPVGNDLDFECKGQFY 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2865NP_001259184.1 SERTA 73..109 CDD:283648 16/35 (46%)
Sertad4XP_017175228.1 SERTA 170..204 CDD:368713 15/33 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849383
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E2MX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.