DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2865 and sertad4

Sequence 1:NP_001259184.1 Gene:CG2865 FlyBaseID:FBgn0023526 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_004914141.1 Gene:sertad4 XenbaseID:XB-GENE-943347 Length:337 Species:Xenopus tropicalis

Alignment Length:295 Identity:67/296 (23%)
Similarity:107/296 (36%) Gaps:77/296 (26%)


  Fly    20 NHSNISSNNSSSSDEDSDMFGPPRCSPPIGYHHHR--------SRVPMISPKLRQREERKRILQL 76
            |||.|.|.....:.:..|.    |....:...|:|        |::.....|..:.|:....|..
 Frog    33 NHSRIGSLPDQINAQHQDY----RLCHSLAESHYRGISHPITTSKITYFKRKYVEEEDYHPPLSC 93

  Fly    77 CAHK---------------MERIK---DSEANLRRSVCINNTYCRLNDELRREKQMRYLQN---L 120
            |:||               :|::|   |.|..|||||.|||...:::.|:       .|||   .
 Frog    94 CSHKNVSIFEERAHVLYMSLEKLKFIDDPEVFLRRSVLINNLMKKIHGEI-------LLQNNWCF 151

  Fly   121 PRTSDSGASTE---LARENLFQPNMDDAKPAGNST----------SNNINANGKPSSSFGDAFGS 172
            ...|..|.:.:   :|::..::..:..||...||.          |:.:|.....|::.|:...|
 Frog   152 SACSLGGPAAQEWFVAQDCPYRKRLRVAKEESNSLQTCCFYQECGSHYLNIPFSVSTTGGNPTAS 216

  Fly   173 SNGSSSGRGGICSLENQPPERQQLGTPAGASAPEAANSAPLSVSG---SASERVNNRKRHLSSCN 234
            |:..||..|  ||....       ...|.|:...:....| |..|   :|....|..|.||.:.|
 Frog   217 SSSPSSMPG--CSHHGD-------YNAADATFHRSTGQFP-SCGGLLTNARPPGNQPKAHLHNEN 271

  Fly   235 LVNDLEILDRELSAINAPMLLIDPEITQGAEQLEK 269
            ..:|      :...:.|..     ::|.|...||:
 Frog   272 STDD------KKGGLGAAY-----DVTNGGSALER 295

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2865NP_001259184.1 SERTA 73..109 CDD:283648 17/54 (31%)
sertad4XP_004914141.1 SERTA 108..143 CDD:283648 13/35 (37%)
MTBP_N 132..>204 CDD:291579 16/79 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280182157
eggNOG 1 0.900 E1_2E2MX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.