DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment temp and AT1G10095

DIOPT Version :8

Sequence 1:NP_001284818.1 Gene:temp / 31212 FlyBaseID:FBgn0027296 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_849630.3 Gene:AT1G10095 / 837545 AraportID:AT1G10095 Length:420 Species:Arabidopsis thaliana

Alignment Length:269 Identity:72/270 (27%)
Similarity:126/270 (47%) Gaps:41/270 (15%)


  Fly    12 CEKIIRDINAVFLKDQDL--------ASFEIIPKEA---------NCNKSPVVHVEHNLGLES-- 57
            |..:::....|...|..:        :.|.::.|||         |...|...:.:|.||:.:  
plant    11 CFSLLKQFEHVLESDPLIDEVGFIHPSQFTMLDKEAGFSNEFQPNNGTSSKFWNQDHKLGISTDI 75

  Fly    58 ---WC--AQHVYDHAHRTLISHRRQTTAQQLRTLQQQ---QQSDSLAKYLNVALLINPDVTTFWH 114
               .|  |:||:..|.:...||.......|::.:...   .:|| :.|:....||::.|..|.|:
plant    76 LVQLCKDAKHVFLLALQEYKSHGNACDESQIKNISCSPCIPESD-VMKHSQSVLLLSSDFGTAWN 139

  Fly   115 IRRQLV-QKNRLS-INKELQFSALVLSIKPKSNEAFAYRRWL-----YSFQSADAIDWPNEIGIC 172
            .|:.:: :|:.|| ..:||:.|.|:||..|||...:::|||:     .||.:...| ...|..:.
plant   140 ARKLILSKKDHLSAFTEELRLSGLILSNSPKSESTWSHRRWIIKMISQSFSTLQEI-ITKESELV 203

  Fly   173 ERAADRCASNYHAWSHRQWILQNGPC--LLQSELLRTEKFMRKHISDYSCYHYRQVLLSRAYELS 235
            |...:|...||.||.||.|::.....  ::| ||.:::::...|::|.||:|||:.|:.:..|..
plant   204 ESIGERSKMNYRAWYHRCWLVSYMTIEQVIQ-ELNKSKRWAGLHVADSSCFHYRRRLMLKILESL 267

  Fly   236 FALPKDSGA 244
            :.  |.|.|
plant   268 YV--KGSSA 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tempNP_001284818.1 PPTA 168..195 CDD:279565 10/27 (37%)
AT1G10095NP_849630.3 PPTA 157..183 CDD:279565 12/26 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I2307
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1527547at2759
OrthoInspector 1 1.000 T193142
orthoMCL 1 0.900 OOG5_132207
Panther 1 1.100 LDO PTHR11129
Phylome 1 0.910 0.667 Consistency score
65.970

Return to query results.
Submit another query.