DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and AT3G09470

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_850546.1 Gene:AT3G09470 AraportID:AT3G09470 Length:437 Species:Arabidopsis thaliana

Alignment Length:464 Identity:92/465 (20%)
Similarity:169/465 (36%) Gaps:112/465 (24%)


  Fly   291 EVGSLLLSALFLVAAGMSLPSIRLMKRYGYGPLIVANYMTVLLFLLSHLYASIYTLLPAYLLLGM 355
            ::|::.|..|::.....|:.:..:::..|....:|.......||:.::|..|.:|::||.|.||.
plant    58 DLGTISLGILYVSFMFCSMVASLVVRLMGSKNALVLGTTGYWLFVAANLKPSWFTMVPASLYLGF 122

  Fly   356 TLSGSAGSKAALIVHFG-GKLSCSCDSQQSQAAVDVLHEEHKMFCNRDQKVRRLARWFRVSQDLG 419
                     ||.|:..| |....|.  .:|.|....|||                     ...:|
plant   123 ---------AASIIWVGQGTYLTSI--ARSHATDHGLHE---------------------GSVIG 155

  Fly   420 LIGGALLASILLACSDGNFTGDCSGLVYYGNESWPPQLRDFYNRNEHGDRICGADMCPLRVQSIL 484
            :..|...|  :.||..           .:||                           |...::|
plant   156 VFNGEFWA--MFACHQ-----------LFGN---------------------------LITLALL 180

  Fly   485 EAGWANGSSIPSSIYAGFIESEPRVAGQSLLWLYVLFSMVSLTLSLLIVVDKVQAIGSSRPERSR 549
            :.|                 .|...:|.:||.|..||||...|: |:..:.|:.......|..| 
plant   181 KDG-----------------KEGSTSGTTLLMLVFLFSMTLGTI-LMFFIRKIDGEDGKGPVGS- 226

  Fly   550 DVSITDTL----------------LFAGPLAYFVGTEQAYMMGDFLRAFVTCSLGIGMIAGALIG 598
            .|.:.|:|                |...||..:.|.:||::..:|.:..||.::|:..:.||:..
plant   227 PVGLVDSLASLPRMIITPLLDIRMLLIVPLLAYSGLQQAFVWAEFTKEIVTPAIGVSGVGGAMAV 291

  Fly   599 MGLMQLIVSCTLSMLLRHVKRIVVILAG--FFFHSCLLLALSSWKPSSDDSALFY--VIAASWGA 659
            .|.:..:.|.|.......:..|..|::|  ....|..|..|..::.:|......|  ::||..|.
plant   292 YGALDAVCSMTAGRFTSGLSSITFIVSGGAVAQASVFLWLLLGYRQTSGVLGTAYPLIMAAILGI 356

  Fly   660 CNGMWETLLLSLVTLNHSSHVTEVQAPLLALRFLGLGLTFAGHGFLCESMKIIALVVLLVISVPP 724
            .:|:..|.:.:|:.|..........|.|...:...:.:.|....::.....:|.::|::.:|:..
plant   357 GDGILNTQISALLALLFKHDTEGAFAQLKVWQSAAIAIVFFLSPYISLQAMLIVMLVMVCVSLFS 421

  Fly   725 YATLEIRLE 733
            :..|.:::|
plant   422 FLFLALKVE 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3078NP_001356930.1 None
AT3G09470NP_850546.1 MFS 34..175 CDD:304372 35/189 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1145833at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19444
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.