DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3078 and UNC93B1

DIOPT Version :9

Sequence 1:NP_001356930.1 Gene:CG3078 / 31211 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_112192.2 Gene:UNC93B1 / 81622 HGNCID:13481 Length:597 Species:Homo sapiens


Alignment Length:521 Identity:107/521 - (20%)
Similarity:189/521 - (36%) Gaps:120/521 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 LAHGLMNCVLLPVMALQGSNAVWHHREEWLPLG------PEVGSLLLSALFLVAAGMSLPSIRLM 315
            |.:|    |.|.::.:|   .:.|:.|.:..:.      |::.|.:|       .|:::..|..:
Human    73 LTYG----VYLGLLQMQ---LILHYDETYREVKYGNMGLPDIDSKML-------MGINVTPIAAL 123

  Fly   316 KRYGYGPLIVANYMTV-LLFLLSHLYA---------SIYTLLPAYLLLGMTLSGSAGSKAALIVH 370
            .   |.|:::..:.|. ::||...:||         ..|||:|:.:.|||.:.....|....|..
Human   124 L---YTPVLIRFFGTKWMMFLAVGIYALFVSTNYWERYYTLVPSAVALGMAIVPLWASMGNYITR 185

  Fly   371 FGGKLSCSCDSQQSQAAVDVLHEEHKMFCNRDQKVRRLARWFRVSQDLGLIGGALLASILLACSD 435
            ...|                 :.|:..:..:|      .:..:.....|.....||....:..|.
Human   186 MAQK-----------------YHEYSHYKEQD------GQGMKQRPPRGSHAPYLLVFQAIFYSF 227

  Fly   436 GNFTGDCSGL--VYYGNESWPPQLRDFYNRNEHGDRICGADMCPLRVQSILEAGWANGSSIPSSI 498
            .:.:..|:.|  :|:.|.    .|.|. |...:..:.||                .|...|.|..
Human   228 FHLSFACAQLPMIYFLNH----YLYDL-NHTLYNVQSCG----------------TNSHGILSGF 271

  Fly   499 YAGFIESEPRVAGQSLLWLYVLFSMVSLTLSLLIVVDKVQAIGSSRPERSRDV-SITDTLLFAGP 562
            ....:.:.|| :|..::...||  |....|::|:|:....|  :.||....|: |:....:|..|
Human   272 NKTVLRTLPR-SGNLIVVESVL--MAVAFLAMLLVLGLCGA--AYRPTEEIDLRSVGWGNIFQLP 331

  Fly   563 ------------LAYFV--GTEQAYMMGDFLRAFVTCSLGIGMIAGALIGMGLMQLIVSCTLSML 613
                        :.:|:  |.|..:........:..||:|:..:|..|:...|.....| .|.:|
Human   332 FKHVRDYRLRHLVPFFIYSGFEVLFACTGIALGYGVCSVGLERLAYLLVAYSLGASAAS-LLGLL 395

  Fly   614 LRHVKRIVVILAGFFFHSCLLLALSSWKPSS---DDSALFYVIAASWGACNGMWETLLLSLVTLN 675
            ...:.|.|.::||...|..|...|..|.|..   ..|.:.||.||.||..:.:.:|.|.:|:.:.
Human   396 GLWLPRPVPLVAGAGVHLLLTFILFFWAPVPRVLQHSWILYVAAALWGVGSALNKTGLSTLLGIL 460

  Fly   676 HSSHVTE---------VQAPLLALRFLGLGLTFAGHGFLCESMKIIALVVLLVISVPPYATLEIR 731
            :.....:         .||..:...:||..|..        ..|:..|:|.||.:...|..:|.:
Human   461 YEDKERQDFIFTIYHWWQAVAIFTVYLGSSLHM--------KAKLAVLLVTLVAAAVSYLRMEQK 517

  Fly   732 L 732
            |
Human   518 L 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3078NP_001356930.1 bZIP <11..>43 CDD:354818
MFS <496..731 CDD:355786 60/261 (23%)
UNC93B1NP_112192.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
MFS_unc93B1 64..520 CDD:340966 107/521 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 522..597
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144963
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.700

Return to query results.
Submit another query.