| Sequence 1: | NP_001356930.1 | Gene: | CG3078 / 31211 | FlyBaseID: | FBgn0023524 | Length: | 765 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_112192.2 | Gene: | UNC93B1 / 81622 | HGNCID: | 13481 | Length: | 597 | Species: | Homo sapiens | 
| Alignment Length: | 521 | Identity: | 107/521 - (20%) | 
|---|---|---|---|
| Similarity: | 189/521 - (36%) | Gaps: | 120/521 - (23%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly   257 LAHGLMNCVLLPVMALQGSNAVWHHREEWLPLG------PEVGSLLLSALFLVAAGMSLPSIRLM 315 
  Fly   316 KRYGYGPLIVANYMTV-LLFLLSHLYA---------SIYTLLPAYLLLGMTLSGSAGSKAALIVH 370 
  Fly   371 FGGKLSCSCDSQQSQAAVDVLHEEHKMFCNRDQKVRRLARWFRVSQDLGLIGGALLASILLACSD 435 
  Fly   436 GNFTGDCSGL--VYYGNESWPPQLRDFYNRNEHGDRICGADMCPLRVQSILEAGWANGSSIPSSI 498 
  Fly   499 YAGFIESEPRVAGQSLLWLYVLFSMVSLTLSLLIVVDKVQAIGSSRPERSRDV-SITDTLLFAGP 562 
  Fly   563 ------------LAYFV--GTEQAYMMGDFLRAFVTCSLGIGMIAGALIGMGLMQLIVSCTLSML 613 
  Fly   614 LRHVKRIVVILAGFFFHSCLLLALSSWKPSS---DDSALFYVIAASWGACNGMWETLLLSLVTLN 675 
  Fly   676 HSSHVTE---------VQAPLLALRFLGLGLTFAGHGFLCESMKIIALVVLLVISVPPYATLEIR 731 
  Fly   732 L 732  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG3078 | NP_001356930.1 | bZIP | <11..>43 | CDD:354818 | |
| MFS | <496..731 | CDD:355786 | 60/261 (23%) | ||
| UNC93B1 | NP_112192.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..29 | ||
| MFS_unc93B1 | 64..520 | CDD:340966 | 107/521 (21%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 522..597 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165144963 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3097 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.700 | |||||