DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and Unc93a

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:XP_008757004.1 Gene:Unc93a RGDID:1583290 Length:454 Species:Rattus norvegicus

Alignment Length:482 Identity:110/483 (23%)
Similarity:202/483 (42%) Gaps:122/483 (25%)


  Fly   293 GSLLLSALFLVAAGMSLPSIRLMKRYGYGPLIVANYMTVLLFLLSHLYASIYTLLPAYLLLGMTL 357
            ||:|||::|       ||.| |:|:.|....||.:....::|.|.:.:|:.|||:|..:|||:..
  Rat    48 GSVLLSSMF-------LPPI-LIKKCGCKWTIVGSMCCYVVFSLGNFHANWYTLIPTSILLGLGA 104

  Fly   358 SGSAGSKAALIVHFG-------GKLSCSCDSQQSQAAVDVLHEEHKMFCNRDQKVRRLARWFRVS 415
            :....::...:...|       |||           ..||:::...:|             |.:.
  Rat   105 APLWSAQCTYLTVIGNLQAEKVGKL-----------GKDVVNQYFGIF-------------FLIF 145

  Fly   416 QDLGLIGGALLASILLACSDGNFTGDCSGLVYYGNESWPPQLRDFYNRNEHGDRI--CGADMCPL 478
            |..| :.|.|::|::                 :|..|....:.|        :::  |||..|  
  Rat   146 QSSG-VWGNLISSLV-----------------FGKMSMQDAIPD--------EQLMSCGAKDC-- 182

  Fly   479 RVQSILEAGWANGSSIPSS--IYAGFIESEPRVAGQSLLWLYVLFSMVSLTLSLLI---VVDKVQ 538
                ::.....|.:..||.  ||             :||.:|....::::.|..:.   |.||::
  Rat   183 ----LMGPSATNTTHHPSQQLIY-------------TLLGIYTSSGVLAILLVAVFLEPVKDKLE 230

  Fly   539 AIGSSRPERSRDVSITDTLLFAGP-------LAYFVGTEQAYMMGDFLRAFVTCSLGIGMIAGAL 596
            ..|.:|........::..:||...       |..:.|.:|.::.|::.:::|||:|||..:...:
  Rat   231 NEGETRSRPLWSTLLSTFMLFRDKRLCLLMFLPVYSGFQQGFLSGEYTKSYVTCALGIRFVGYVM 295

  Fly   597 IGMGLMQLIVSCTLSMLLRHVKRIVVILAGFFFH-SCLLLALSSWKPSSDDSALFYVIAASWGAC 660
            |....|..:.|.....:.::..||.:.:.|...| ||:::.| .|.|:.....:|:|::..||..
  Rat   296 ICFSAMTALCSLLYGKISKYTGRITLYVLGAAIHFSCIVVFL-LWHPNPAQLPVFFVLSGLWGMA 359

  Fly   661 NGMWET---LLLSLVTLNHSSHVTEVQAPLLALRFLG--LG--LTFAGHGFLCESMKIIALVVLL 718
            :.:|:|   :|..::       ..|.:.|..|...||  :|  :.|....|||.|.|:..|:.:|
  Rat   360 DAVWQTQNNVLFGVL-------FEENKEPAFANYRLGEAVGFVIAFGYSSFLCVSTKLYILLGVL 417

  Fly   719 VISVPPYATLEIR--------LEAQRK 737
            .:::..|.|:|.|        |.|:.|
  Rat   418 SVAMVSYGTVEYREYKAASKVLAAEEK 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3078NP_001356930.1 None
Unc93aXP_008757004.1 MFS 8..424 CDD:119392 103/461 (22%)
MFS_1 10..379 CDD:284993 90/416 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C335097828
eggNOG 1 0.900 E1_KOG3097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1145833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19444
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.