DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and unc93a

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:XP_005170239.1 Gene:unc93a ZFINID:ZDB-GENE-041014-304 Length:471 Species:Danio rerio

Alignment Length:500 Identity:107/500 (21%)
Similarity:190/500 (38%) Gaps:106/500 (21%)


  Fly   252 FSCLSLAHGLMNCVLLPVMALQGS-NAVWHHREEWLPLGPEVGSLLLSALF--LVAAGMSLPSIR 313
            |..|..|:|       .:.:||.| ||     ||.:      |.:.||.::  ::.:.|.||.| 
Zfish    19 FLLLFTAYG-------GLQSLQSSLNA-----EEGM------GVISLSVIYAAIILSSMFLPPI- 64

  Fly   314 LMKRYGYGPLIVANYMTVLLFLLSHLYASIYTLLPAYLLLGMTLSGSAGSKAALIVHFGGKLSCS 378
            ::|..|....||.:....:.:...:|.....:|:....:|||..|....:|...:...|.:..  
Zfish    65 MIKNLGCKWTIVVSMGCYVAYSFGNLAPGWASLMSTSAILGMGGSPLWSAKCTYLTISGNRQG-- 127

  Fly   379 CDSQQSQAAVDVLHEEHKMFCNRDQKVRRLARWFRVSQDLGLIGGALLASILLACSDGNFTGDCS 443
              .:.::...|::::...:|             |.:.|..| :.|.|::|::.. .|.|..    
Zfish   128 --QKHNKKGQDLINQYFGIF-------------FFIFQSSG-VWGNLMSSLIFG-QDQNIV---- 171

  Fly   444 GLVYYGNESWPPQLRDFYNRNEHGDRICGADMCPLRVQSILEAGWANGSSIPSSIYAGFIESEPR 508
                    ..|.:..:|          ||...|   :.:....|   .|:.||....        
Zfish   172 --------EVPKENLEF----------CGVSTC---LDNFTVIG---NSTRPSKHLV-------- 204

  Fly   509 VAGQSLLWLYVLFSMVSLTLSLLIVV-------DKVQAIGSSRPERS------------RDVSIT 554
               .:||..|:   .|.|...:.:.|       |:.:...|::..:|            ||    
Zfish   205 ---DTLLGCYI---GVGLLAIIFVAVFLDNIDRDEAKEFRSTKGNKSFWDTFLATFKLLRD---- 259

  Fly   555 DTLLFAGPLAYFVGTEQAYMMGDFLRAFVTCSLGIGMIAGALIGMGLMQLIVSCTLSMLLRHVKR 619
            ..||...||..:.|.||:::.|::.:.:|||:|||..:...:|.......:.|.....|.::..|
Zfish   260 PRLLLLIPLTMYSGFEQSFLSGEYTKNYVTCALGIHNVGFVMICFAASNSLCSFAFGRLAQYTGR 324

  Fly   620 IVVILAGFFFHSCLLLALSSWKPSSDDSALFYVIAASWGACNGMWETLLLSLVTLNHSSHVTEVQ 684
            |.:.......:....|.|..|||..|..|:|:|..|.||..:.:|:|...:|..:..:.:.....
Zfish   325 IALFCLAAAINLGSFLGLLYWKPHPDQLAIFFVFPALWGMADAVWQTQTNALYGILFAKNKEAAF 389

  Fly   685 APLLALRFLGLGLTFAGHGFLCESMKIIALVVLLVISVPPYATLE 729
            |.......||..:.||...|:|.|.||...:.:|.:::..|..:|
Zfish   390 ANYRMWESLGFVIAFAYSTFICLSTKIYIALAVLALTMVTYLYVE 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3078NP_001356930.1 None
unc93aXP_005170239.1 MFS 15..153 CDD:304372 34/170 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C335093458
eggNOG 1 0.900 E1_KOG3097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1145833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19444
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.