DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and Unc93b1

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_062322.2 Gene:Unc93b1 MGIID:1859307 Length:619 Species:Mus musculus

Alignment Length:527 Identity:111/528 (21%)
Similarity:204/528 (39%) Gaps:126/528 (24%)


  Fly   255 LSLAHGLMNCVLLPVMALQGSNAVWHHREEWLPLG------PEVGSLLLSALFLVAAGMSLPSIR 313
            ::|.:|    |.|.::.:|   .:.|:.|.:..:.      |::.|.:|       .|:::..|.
Mouse    92 VTLTYG----VYLGLLQMQ---LILHYDETYREVKYGNMGLPDIDSKML-------MGINVTPIA 142

  Fly   314 LMKRYGYGPLIVANYMTV-LLFLLSHLYA---------SIYTLLPAYLLLGMTLSGSAGSKAALI 368
            .:.   |.|:::..:.|. ::||...:||         ..|||:|:.:.|||.:       ..|.
Mouse   143 ALL---YTPVLIRFFGTKWMMFLAVGIYALFVSTNYWERYYTLVPSAVALGMAI-------VPLW 197

  Fly   369 VHFGGKLSCSCDSQQSQAAVDVLHEEHKMFCNRDQKVRR--LARWFRVSQDLGLIGGALLAS--- 428
            ...|..:     ::.||...:..|.:.:......|:..|  .|.:..|.|       |:..|   
Mouse   198 ASMGNYI-----TRMSQKYYEYSHYKEQDEQGPQQRPPRGSHAPYLLVFQ-------AIFYSFFH 250

  Fly   429 ILLACSDGNFTGDCSGLVYYGNESWPPQLRDFYNRNEHGDRICGADMCPLRVQSILEAGWANGSS 493
            :..||:.       ..::|:.|..       .|:.|.   .:.....|..:.|.||     ||.:
Mouse   251 LSFACAQ-------LPMIYFLNNY-------LYDLNH---TLINVQSCGTKSQGIL-----NGFN 293

  Fly   494 IPSSIYAGFIESEPRVAGQSLLWLYVLFSMVSLTLSLLIVVDKVQAIGSSRPERSRDV-SITDTL 557
              .::......|:..:..:|:|       |....|::|:|:....|  :.||....|: |:....
Mouse   294 --KTVLRTLPRSKNLIVVESVL-------MAVAFLAMLMVLGLCGA--AYRPTEEIDLRSVGWGN 347

  Fly   558 LFAGP------------LAYFV--GTEQAYMMGDFLRAFVTCSLGIGMIAGALIGMGLMQLIVSC 608
            :|..|            :.:|:  |.|..:....|...:..||:|:..:|..||...| ....|.
Mouse   348 IFQLPFKHVRDFRLRHLVPFFIYSGFEVLFACTGFALGYGVCSMGLERLAYLLIAYSL-GASASS 411

  Fly   609 TLSMLLRHVKRIVVILAGFFFHSCLLLALSSWKPSS---DDSALFYVIAASWGACNGMWETLLLS 670
            .|.:|...:.|.|.::||...|..|.|:|..|.|:.   ..|.:||.:||.||..:.:.:|.|.:
Mouse   412 VLGLLGLWLPRSVPLVAGAGLHLLLTLSLFFWAPAPRVLQHSWIFYFVAALWGVGSALNKTGLST 476

  Fly   671 LVTLNHSSHVTE---------VQAPLLALRFLGLGLTFAGHGFLCESMKIIALVVLLVISVPPYA 726
            |:.:.:.....:         .||..:.:.:||..|..        ..|:..|:|.||.:...|.
Mouse   477 LLGILYEDKERQDFIFTIYHWWQAVAIFVVYLGSSLPM--------KAKLAVLLVTLVAAAASYL 533

  Fly   727 TLEIRLE 733
            .:|.:|:
Mouse   534 WMEQKLQ 540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3078NP_001356930.1 None
Unc93b1NP_062322.2 MFS <145..>210 CDD:304372 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C335095149
eggNOG 1 0.900 E1_KOG3097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.