DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and UNC93A

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_061847.2 Gene:UNC93A HGNCID:12570 Length:457 Species:Homo sapiens

Alignment Length:512 Identity:111/513 (22%)
Similarity:199/513 (39%) Gaps:131/513 (26%)


  Fly   252 FSCLSLAHGLMNCVLLPVMALQGSNAVWHHREEWL---PLGPEVGSLLLSALFLVAAGMSLPSIR 313
            |..|..|:|       .:.:||.|    .:.||.|   .|....|.:|||::|       ||.: 
Human    15 FLLLFTAYG-------GLQSLQSS----LYSEEGLGVTALSTLYGGMLLSSMF-------LPPL- 60

  Fly   314 LMKRYGYGPLIVANYMTVLLFLLSHLYASIYTLLPAYLLLG-------------MTLSGSAGSKA 365
            |::|.|....|:.:....:.|.:.:.:||.|||:|..:|||             :|::|:..::.
Human    61 LIERLGCKGTIILSMCGYVAFSVGNFFASWYTLIPTSILLGLGAAPLWSAQCTYLTITGNTHAEK 125

  Fly   366 ALIVHFGGKLSCSCDSQQSQAAVDVLHEEHKMFCNRDQKVRRLARWFRVSQDLGLIGGALLASIL 430
            |      ||           ...|::::...:|             |.:.|..| :.|.|::|::
Human   126 A------GK-----------RGKDMVNQYFGIF-------------FLIFQSSG-VWGNLISSLV 159

  Fly   431 LACSDGNFTGDCSGLVYYGNESWP-PQLRDFYNRNEHGDRICGADMCPLRVQSILEAGWANGSSI 494
            ...:.             ..|:.| .||..           |||..|      ::.....|.:..
Human   160 FGQTP-------------SQETLPEEQLTS-----------CGASDC------LMATTTTNSTQR 194

  Fly   495 PSS--IYAGFIESEPRVAGQSLLWLYVLFSMVSLTLSLLIVVDKVQAIGSSRPE---RSRDVSIT 554
            ||.  :|             :||.:|.    .|..|::|::...:|.|...:.|   ..:.|...
Human   195 PSQQLVY-------------TLLGIYT----GSGVLAVLMIAAFLQPIRDVQRESEGEKKSVPFW 242

  Fly   555 DTLLFAGP------------LAYFVGTEQAYMMGDFLRAFVTCSLGIGMIAGALIGMGLMQLIVS 607
            .|||....            |..:.|.:|.::..::.|::|||:|||..:...:|.......:.|
Human   243 STLLSTFKLYRDKRLCLLILLPLYSGLQQGFLSSEYTRSYVTCTLGIQFVGYVMICFSATDALCS 307

  Fly   608 CTLSMLLRHVKRIVVILAGFFFHSCLLLALSSWKPSSDDSALFYVIAASWGACNGMWETLLLSLV 672
            .....:.::..|.|:.:.|...|...::||..|:|.:|..|:|:|.:..||..:.:|:|...:|.
Human   308 VLYGKVSQYTGRAVLYVLGAVTHVSCMIALLLWRPRADHLAVFFVFSGLWGVADAVWQTQNNALY 372

  Fly   673 TLNHSSHVTEVQAPLLALRFLGLGLTFAGHGFLCESMKIIALVVLLVISVPPYATLE 729
            .:..........|.......||..:.|....|||..:|:..|:.:|.:::..|..:|
Human   373 GVLFEKSKEAAFANYRLWEALGFVIAFGYSMFLCVHVKLYILLGVLSLTMVAYGLVE 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3078NP_001356930.1 None
UNC93ANP_061847.2 MFS 8..428 CDD:119392 110/510 (22%)
MFS_1 11..398 CDD:284993 102/480 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C335081691
eggNOG 1 0.900 E1_KOG3097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4703
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1145833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19444
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.