DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and Unc93a

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_954860.1 Gene:Unc93a MGIID:1933250 Length:458 Species:Mus musculus

Alignment Length:476 Identity:108/477 (23%)
Similarity:195/477 (41%) Gaps:117/477 (25%)


  Fly   294 SLLLSALFLVAAGMSLPSIRLMKRYGYGPLIVANYMTVLLFLLSHLYASIYTLLPAYLLLGMTLS 358
            |:|||::|       ||.| |:|:.|....||.:....::|.|.:.:|:.|||:|..:|||:..:
Mouse    49 SVLLSSMF-------LPPI-LIKKCGCKWTIVGSMCCYVVFSLGNFHANWYTLIPTSILLGLGAA 105

  Fly   359 GSAGSKAALIVHFG-------GKLSCSCDSQQSQAAVDVLHEEHKMFCNRDQKVRRLARWFRVSQ 416
            ....::...:...|       |||           ..||:::...:|             |.|.|
Mouse   106 PLWSAQGTYLTTMGNLQAEKVGKL-----------GKDVVNQYFGIF-------------FLVFQ 146

  Fly   417 DLGLIGGALLASILLACSDGNFTGDCSGLVYYGNESWPPQLRDFYNRNEHGDRICGADMCPLRVQ 481
            ..| :.|.|::|::                 :|..|....:      .|.....|||..|     
Mouse   147 SSG-VWGNLISSLV-----------------FGKMSMQEAI------PEEQLMSCGAKDC----- 182

  Fly   482 SILEAGWANGSSIPSS--IYAGFIESEPRVAGQSLLWLYVLFSMVSLTLSLLIVV------DKVQ 538
             ::.....|.:..||.  ||             :||.:|....::::   ||:.|      ||::
Mouse   183 -LMGPAATNSTHHPSQQLIY-------------TLLGIYTGCGVLAI---LLVAVFLESLEDKLE 230

  Fly   539 AIGSSRPERSRDVSITDTLL---------------FAGPLAYFVGTEQAYMMGDFLRAFVTCSLG 588
            ..|..||   |...:..|||               |   |..:.|.:|.::.|::.:::|||:||
Mouse   231 NEGERRP---RPPPLWSTLLSTFMLFRDKRLCLLMF---LPLYSGFQQEFLSGEYTKSYVTCALG 289

  Fly   589 IGMIAGALIGMGLMQLIVSCTLSMLLRHVKRIVVILAGFFFH-SCLLLALSSWKPSSDDSALFYV 652
            |..:...:|....|..:.|.....:.::..|..:...|...| ||:::.| .|.|:::...:|:|
Mouse   290 IHFVGYVMICFSAMTALCSLLYGKISKYTGRAALYALGAAIHFSCIVVFL-LWHPNTNQLPVFFV 353

  Fly   653 IAASWGACNGMWETLLLSLVTLNHSSHVTEVQAPLLALRFLGLGLTFAGHGFLCESMKIIALVVL 717
            ::..||..:.:|:|...:|..:....:.....|.......:|..:.|....|||.|.|:..|:.:
Mouse   354 LSGLWGMSDAVWQTQNNALFGVLFEENKEPAFANYRLGEAIGFVIAFGYSSFLCVSTKLYILLGV 418

  Fly   718 LVISVPPYATLE-IRLEAQRK 737
            |.:::..|.|:| :.::|..|
Mouse   419 LSLAMVGYGTVEYLEVKAASK 439

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3078NP_001356930.1 None
Unc93aNP_954860.1 MFS 8..424 CDD:119392 103/460 (22%)
MFS_1 10..404 CDD:284993 96/440 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C335115066
eggNOG 1 0.900 E1_KOG3097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19444
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.