DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and Unc93b1

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_001101983.1 Gene:Unc93b1 RGDID:1311984 Length:630 Species:Rattus norvegicus

Alignment Length:527 Identity:111/528 (21%)
Similarity:201/528 (38%) Gaps:117/528 (22%)


  Fly   256 SLAHGLMNCVLLPVMALQGSNAVWHHREEWLPLG------PEVGSLLLSALFL--VAAGMSLP-- 310
            :|.:|    |.|.::.:|   .:.|:.|.:..:.      |::.|.:|..:.:  :||.:..|  
  Rat    93 TLTYG----VYLGLLQMQ---LILHYDETYREVKYGNMGLPDIDSKMLMGINVTPIAALLYTPVL 150

  Fly   311 -------SIRLMKRYGYGPLIVANYMTVLLFLLSHLYASIYTLLPAYLLLGMTLSGSAGSKAALI 368
                   |:.|.:.:|...::........||:.::.:...|||:|:.:.|||.:       ..|.
  Rat   151 IRPKVLMSLPLYRFFGTKWMMFLAVGIYALFVSTNYWERYYTLVPSAVALGMAI-------VPLW 208

  Fly   369 VHFGGKLSCSCDSQQSQAAVDVLHEEHKMFCNRDQKVRR--LARWFRVSQDLGLIGGALLAS--- 428
            ...|..:     ::.||...:..|.:.:......|:..|  .|.:..|.|       |:..|   
  Rat   209 ASMGNYI-----TRMSQKYYEYSHYKEQDEQGPQQRPPRGSHAPYLLVFQ-------AIFYSFFH 261

  Fly   429 ILLACSDGNFTGDCSGLVYYGNESWPPQLRDFYNRNEHGDRICGADMCPLRVQSILEAGWANGSS 493
            :..||:.       ..:||:.|.    .|.|. |......:.||..          ..|..||.:
  Rat   262 LSFACAQ-------LPMVYFLNH----YLYDL-NHTLFNVKSCGTK----------SYGILNGFN 304

  Fly   494 IPSSIYAGFIESEPRVAGQSLLWLYVLFSMVSLTLSLLIVVDKVQAIGSSRPERSRDV-SITDTL 557
              .::......|...:..:|:|       |....|::|:|:....|  :.||....|: |:....
  Rat   305 --KTVLRTLPRSRNLIVVESVL-------MAVAFLAMLLVLGLCGA--AYRPTEEIDLRSVGWGN 358

  Fly   558 LFAGP------------LAYFV--GTEQAYMMGDFLRAFVTCSLGIGMIAGALIGMGLMQLIVSC 608
            :|..|            :.:|:  |.|..:....|...:..||:|:..:|..||...|.....| 
  Rat   359 IFQLPFKHVRDFRLRHLVPFFIYSGFEVLFACTGFTLGYGVCSMGLERLAYLLIAYSLGASAAS- 422

  Fly   609 TLSMLLRHVKRIVVILAGFFFHSCLLLALSSWKPSS---DDSALFYVIAASWGACNGMWETLLLS 670
            .|.:|...:.|.|.::||...|..|.|:|..|.|:.   ..|.:||.:||.||..:.:.:|.|.:
  Rat   423 VLGLLGLWLPRSVPLVAGAGLHLLLTLSLFFWAPAPRVLQHSWIFYFVAALWGVGSALNKTGLST 487

  Fly   671 LVTLNHSSHVTE---------VQAPLLALRFLGLGLTFAGHGFLCESMKIIALVVLLVISVPPYA 726
            |:.:.:.....:         .||..:.:.:||..|..        ..|:..|:|.||.:...|.
  Rat   488 LLGILYEDKERQDFIFTIYHWWQAVAIFVVYLGSSLPM--------KAKLAVLLVTLVAAATSYL 544

  Fly   727 TLEIRLE 733
            .:|.:|:
  Rat   545 WMENKLQ 551



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C335082492
eggNOG 1 0.900 E1_KOG3097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.