DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and CG2121

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_001137618.1 Gene:CG2121 FlyBaseID:FBgn0033289 Length:536 Species:Drosophila melanogaster

Alignment Length:542 Identity:123/543 (23%)
Similarity:208/543 (38%) Gaps:99/543 (18%)


  Fly   232 NNRNCRHKVPAHVRQKVWRQFSCLSLA--------HGLMNCVLLPVMALQGS-NAVWHHREEWL- 286
            |..|.||..||. |..:.:....:.||        ||..|        ||.| ||     ::.| 
  Fly    62 NKVNQRHYEPAE-RFIITKNVVVIGLAFMIHFTAFHGTSN--------LQSSVNA-----DKALG 112

  Fly   287 --PLGPEVGSLLLSALFLVAAGMSLPSIRL---MKRYGYGPLIVANYMTVLLFLLSHLYASIYTL 346
              .|....|||:||.:||....:.....||   :..:.|.|.|.|.:           |....||
  Fly   113 TTTLAVIYGSLILSNIFLPMTVIRWFGCRLTMALALFAYMPYIAAQF-----------YPRFETL 166

  Fly   347 LPAYLLLGMTLSGSAGSKAALIVHFGGKLSCS-CD--SQQSQAAVDVLHEEHKMFCNRDQKVRRL 408
            :||.|::|..               ||.|.|| |.  |..|:|...|...:.:    :|....:.
  Fly   167 IPAALMVGFG---------------GGPLWCSKCTYLSTVSEALTQVRGNKSR----KDVNTVKF 212

  Fly   409 ARWFRVSQDLGLIGGALLASILLACSDGNFTGDCSGLVYYGNESWPPQLRDFYNRNEHGDRICGA 473
            ...|.:...:..:.|.|::|.:|..|       ........|:|:..:::....||...: :|||
  Fly   213 FGLFFIFYQMAQVWGNLISSSVLTLS-------APAAQSAANDSFELEVQRELERNRVAE-LCGA 269

  Fly   474 DMCPLRVQSILEAGWANGSSIPSSIYAGFIESEPRVAGQSLLWLYVLFSMVSLTLSLLIVVDKVQ 538
            ..||      .....||.:.:|           |......||....|..|.:..:.::..|..::
  Fly   270 RFCP------GVGAEANPNLVP-----------PAPEQIQLLNSIFLTCMAAAVVMMIFGVSSLK 317

  Fly   539 AIGSSRPERSRDVS----ITDTL--------LFAGPLAYFVGTEQAYMMGDFLRAFVTCSLGIGM 591
            ..|..|.:....:|    :|.|:        :...|:..|:|.|:|::..||.|:||.|..||..
  Fly   318 RYGVKRGDTGDGMSGLKLLTVTINLLRKRRQILMLPITMFIGLEEAFLAVDFTRSFVACGWGISR 382

  Fly   592 IAGALIGMGLMQLIVSCTLSMLLRHVKRIVVILAGFFFHSCLLLALSSWKPSSDDSALFYVIAAS 656
            |..|:|..|:...:.:.....|:..:.|:.:.......:.|||..:.:|:....|...:...||.
  Fly   383 IGFAMICFGVANAVAAGIAGALVERIGRVTLAALCAVVNLCLLTYMYTWEAREGDYMSYCTFAAV 447

  Fly   657 WGACNGMWETLLLSLVTLNHSSHVTEVQAPLLALRFLGLGLTFAGHGFLCESMKIIALVVLLVIS 721
            ||.|:|:|..::.:...:...:|:....:........|..:.:.....||.|.|::.|::.:::.
  Fly   448 WGICDGVWLVVVNAFYGILFPNHLIAAYSNFRLWESTGSVIGYVISSQLCTSTKLVILIIFILVG 512

  Fly   722 VPPYATLEIRLEAQRKATLVSL 743
            ...|..:|.|...::|...|.|
  Fly   513 CVGYGLIEYRFWQKQKNLEVML 534

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3078NP_001356930.1 None
CG2121NP_001137618.1 MFS 84..>189 CDD:304372 38/144 (26%)
MFS_1 <296..476 CDD:284993 40/180 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334115824
eggNOG 1 0.900 E1_KOG3097
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4703
OrthoDB 1 1.010 D1145833at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19444
RoundUp 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.