DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and CG4928

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_573179.1 Gene:CG4928 FlyBaseID:FBgn0027556 Length:538 Species:Drosophila melanogaster

Alignment Length:529 Identity:110/530 (21%)
Similarity:217/530 (41%) Gaps:97/530 (18%)


  Fly   242 AHVRQKV-------WR---QFSCLSLAHGLMNCVLLPVMALQGSNAVWHHREEWLPLGPEVGSLL 296
            |.:|:||       ||   ..|.:|:|      .::...|.||:    .:.:..:.....:|::.
  Fly    26 ASLREKVVLNPGEKWRILKNISIISIA------FMVQFTAFQGT----ANLQSSINAKDGLGTVS 80

  Fly   297 LSALF--LVAAGMSLPSIRLMKRYGYGPLIVANYMTVLLFLLSHLYASIYTLLPAYLLLGMTLSG 359
            |||::  ||.:.:.||:: ::::......:|.:.:....::...|:...|||:||.:|:||..:.
  Fly    81 LSAIYAALVVSCIFLPTL-IIRKLTVKWTLVCSMLCYAPYIAFQLFPRFYTLVPAGILVGMGAAP 144

  Fly   360 SAGSKAALIVHFGGKLSCSCDSQQSQAAVDVLHEEHKMFCNRDQKVRRLARWFRVSQDLGLIGGA 424
            ...|||..:...|     ...::.::.|||.:             :.|...:|.::.....:.|.
  Fly   145 MWASKATYLTQVG-----QVYAKITEQAVDAI-------------IVRFFGFFFLAWQSAELWGN 191

  Fly   425 LLASILLACSDGNFTGDCSGLVYYGNESWPPQLRDFYNRNEHGDRICGADMCPLRVQSILEAGWA 489
            |::|::|  |.|...|..|.......|..               :.|||:.|     :....|..
  Fly   192 LISSLVL--SSGAHGGGSSSNTTVSEEDL---------------QFCGANFC-----TTGSGGHG 234

  Fly   490 NGSSIPSSIYAGFIESEPRVAGQSLLWLYVLFSMVSLTLSLLIVVDKVQAIGSSRPERSRDVSIT 554
            |....|          |..:...|:::|..:.:.|.:   :...:|.::..|..|...:....::
  Fly   235 NLERPP----------EDEIFEISMIYLSCIVAAVCI---IAFFLDPLKRYGEKRKGSNSAAELS 286

  Fly   555 DTLLFAG--------------PLAYFVGTEQAYMMGDFLRAFVTCSLGIGMIAGALIGMGLMQLI 605
            ...|.:.              |:..|:|.|||::..||.:|:|.|:||:..|...:|..|::..:
  Fly   287 GLQLLSATFRQMKKPNLQLLIPITVFIGMEQAFIGADFTQAYVACALGVNKIGFVMICFGVVNAL 351

  Fly   606 VSCTLSMLLRHVKRIVVILAGFFFHSCLLLALSSWKPSSDDSALFYVIAASWGACNGMWETLLLS 670
            .|.....:::::.|..:|:.|...|..|:.....|:|:.|:..:||.::..||..:.:|:|.:..
  Fly   352 CSILFGSVMKYIGRTPIIVLGAVVHFTLITVELFWRPNPDNPIIFYAMSGLWGVGDAVWQTQING 416

  Fly   671 LVTLNHSSHVTEVQAPLLALRFLGLGLTFAGHGFLCESMKIIALVVLLVISVPPYATLEI----- 730
            |..|....:.....:........|..:.:|....||..||:..|:.:|.:....|..:||     
  Fly   417 LYGLLFRRNKEAAFSNYRLWESAGFVIAYAYATTLCTQMKLYILLAVLTLGCIGYVIVEILYRKK 481

  Fly   731 --RLEAQRK 737
              :|:.|.|
  Fly   482 QRKLKKQEK 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3078NP_001356930.1 None
CG4928NP_573179.1 MFS 49..>155 CDD:328737 26/117 (22%)
MFS_1 <255..426 CDD:331686 38/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334115860
eggNOG 1 0.900 E1_KOG3097
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4703
OrthoDB 1 1.010 D1145833at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19444
RoundUp 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.