DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and Y52E8A.6

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_001263659.1 Gene:Y52E8A.6 WormBaseID:WBGene00021798 Length:436 Species:Caenorhabditis elegans

Alignment Length:523 Identity:96/524 (18%)
Similarity:168/524 (32%) Gaps:219/524 (42%)


  Fly   297 LSALFLVAAGMSLPSI-RLMKRYGYGPLIVANYMTVLLFLLSHLYASIYTLLPAYLLLGMTLSGS 360
            ||.||:.      |.| ::..::|    :|..:...:.|....::.:.|     |:.:   .|.|
 Worm    63 LSCLFVA------PIIDKISAKWG----MVLRFSAYIAFQYGFIHMNTY-----YVYI---TSAS 109

  Fly   361 AGSKAALI-VHFGGKLSCSCDSQQSQAAVDVLHEEHKMFCNRDQKVRRLA-RWFRVSQDLGLIGG 423
            .|...|.| |..|..|:.:|.|:..:                    |.:| .||...  ..|:||
 Worm   110 LGVGGAFIWVGQGKYLTENCTSETIE--------------------RNIALTWFIFK--FCLLGG 152

  Fly   424 ALLASILLACSDGNFTGDCSGLVYYGNESWPPQLRDFYNRN-----EHGD-----RICGADMCPL 478
            .:...:|                             |||:.     |.||     .||    |.:
 Worm   153 GIFLYVL-----------------------------FYNQKMNEFLESGDYKTFVYIC----CSI 184

  Fly   479 RVQSILEAGWANGSSIPSSIYAGFIESEPRVAGQSLLWLYVLFSMVSLTLSLLIVVDKVQAIGSS 543
               |:|.|  .|.:.:|.|:|.                                           
 Worm   185 ---SLLAA--INTAFLPQSVYV------------------------------------------- 201

  Fly   544 RPERSRDVSITDTL------LFAGPLAYFVGTEQAYMMGDFLRAF-----VTC-----SLG---I 589
             |||.:..:...||      :...|:...|   ..::...|.|:|     .||     :||   .
 Worm   202 -PERKKHETFAKTLKATFKIMRESPMLLLV---SIFLYTGFSRSFWIAIYPTCIKFTPALGDNTA 262

  Fly   590 GMIAGALIGMGLMQLIVSCTLSMLLRHV----KRIVVILAGFFFHSCLLLA-------------- 636
            .::|.:.|..|:.|::.....|:|.:.|    |.::|::|......|.:|.              
 Worm   263 KLLAMSGIATGIGQIVAGGIFSVLGKRVRILGKDMIVVIACVLHLICFVLIYLFFPYDAPLHPTQ 327

  Fly   637 -LSSWKPSSDDSALFYVIAASWGACNGMW-------ETLLLSLVT---LNHSSHVTEVQAPLLAL 690
             :.:::|:: ..|:|         |:|:.       :|.:.|.:.   ...|||...:.....|:
 Worm   328 NVGTFEPNA-YIAIF---------CSGLLGFGDAIIQTQVYSFLCDGYSEESSHAFALFKFYSAI 382

  Fly   691 R-----FLGLGLTFAGHGFLCESMKIIALVVLLVISVPPYATLEIRLEAQR----KATLVSLXRS 746
            .     |:....|.|||..|.....|::.:..::              |||    |...::|..|
 Worm   383 SSTIAFFVSKYFTLAGHLVLYGVFAILSAITTVL--------------AQRLYFHKTRHLNLNLS 433

  Fly   747 IFS 749
            :|:
 Worm   434 LFN 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3078NP_001356930.1 None
Y52E8A.6NP_001263659.1 MFS 13..165 CDD:304372 32/171 (19%)
MFS_1 17..387 CDD:284993 82/459 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1145833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.