DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and plep-1

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_001300605.1 Gene:plep-1 WormBaseID:WBGene00021797 Length:456 Species:Caenorhabditis elegans

Alignment Length:558 Identity:96/559 (17%)
Similarity:181/559 (32%) Gaps:204/559 (36%)


  Fly   213 RESINSSIGATSIRRLITLNNRNCRHKVPAHVRQKVWRQFSCLSLAHGLMNCVLLPVMALQGSNA 277
            ||::|....:||...|.:        .|.:|       :|....|.|||....:..:.|..    
 Worm     6 RETVNMLRVSTSFLILFS--------AVLSH-------EFIAEPLFHGLSEANIGGIQARD---- 51

  Fly   278 VWHHREEWLPLGPEVGSLLLSALFLVAAGMSLPSIRLMKRYGYGPLIVA----NYMTVLLFLLSH 338
                           |.|:|..|:........          :.|.:|:    .:..||..:.:.
 Worm    52 ---------------GYLMLCILYFTNTVSCF----------FAPFVVSRISGKWAMVLGMVAAF 91

  Fly   339 LYASIYTLLPAYLLLGMTLSGSAGSKAALIVHFGGKLSCSCDSQQSQAAVDVLHEEHKMFCNRDQ 403
            ...:.|.....|:|:..:..|.||   |.::..|          |.|...:.:.|     .||::
 Worm    92 CMQAAYMFPNRYILMVTSALGGAG---ATLLWVG----------QGQYITENISE-----ANREK 138

  Fly   404 KVRRLARWFRVSQDLGLIGGALLASILLACSDGNFTGDCSGLVYYGNESWPPQLRDFYNRNEHGD 468
            .......::::|    ||.|                    |:.::           ||.:|    
 Worm   139 NTSIQWGFYKMS----LIFG--------------------GVFFF-----------FYFQN---- 164

  Fly   469 RICGADMCPLRVQSILEAGWANGSSIPSSIYAGFIESEPRVAGQSLLWLYVLFSMVSLTLSLLIV 533
                         |.::|..|||.                         ..:|.:|.:|.::|.:
 Worm   165 -------------SSIDAIVANGQ-------------------------MQIFFIVFMTFTVLSI 191

  Fly   534 VDKVQAIGSSRPERSRDVSITDTLLFAGPLA------------YFVGTEQAYMMGDF-------- 578
            ::.:....|...:....:...:|.:.:..|.            ::.|..:::.:..:        
 Worm   192 INSIFLPQSQVSQNQAILPFCETFVNSFKLLKTPRMFCFTIFFFYTGLIRSFWISIYPACIKFTS 256

  Fly   579 -LRAFVTCSLGIGMIAGALIGMGLMQLIVSCTLSMLLRHVKRI---VVILAGFFFHSCLLLALSS 639
             |....|..|.||||   :.|.|  |:|.|.:::::...:::.   .:||.....|..|.:.:|.
 Worm   257 QLSTNTTAILTIGMI---VTGCG--QVIGSLSVAVIGNKIRKFGQHTLILCALILHIFLCVMISL 316

  Fly   640 WKPSSDDSALFY----------------VIAASWGACNGMWETLLLSLVT---LNHSSHVTEVQA 685
            ..|  :|:.|.:                .|:|..|..:.:.:|.:.|.:.   .|.||.|..:  
 Worm   317 TFP--NDAPLGHTDKNGPVFGASVLSAMTISALLGFGDAILQTQVYSYIAKYYQNESSTVFSI-- 377

  Fly   686 PLLALRF-LGLGLT---FAGHGF-LCESMKIIALVVLL 718
                .|| .|:..|   ||...| |...:.:||:..:|
 Worm   378 ----FRFSSGIASTLLFFAAQYFHLMHHLILIAIFAVL 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3078NP_001356930.1 None
plep-1NP_001300605.1 UNC-93 14..170 CDD:114686 42/270 (16%)
MFS_1 54..388 CDD:284993 74/452 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1145833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.