DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and unc-93

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_001021218.1 Gene:unc-93 WormBaseID:WBGene00006822 Length:705 Species:Caenorhabditis elegans

Alignment Length:561 Identity:111/562 (20%)
Similarity:211/562 (38%) Gaps:142/562 (25%)


  Fly   205 AALAASRRRESINSSIGATSIRRLITLNNRNCRHKVPAHVRQKVWRQFSCLSLA--------HGL 261
            |.|...::||.::.:             .:...:|:...:...:|    .||:|        :||
 Worm   220 AKLVRKKKREMMSGT-------------EKERANKIKRKIMSNLW----ILSVAFLFLFTAFNGL 267

  Fly   262 MNCVLLPVMALQGSNAVWHHREEWLPLGPEVGSLLLSALFLVAAGMSL--PSIRLMKRYGYGPLI 324
            .|        ||.|            :..::||..|.||:|..|..||  ||. ::.|.|.....
 Worm   268 QN--------LQTS------------VNGDLGSDSLVALYLSLAISSLFVPSF-MINRLGCKLTF 311

  Fly   325 VANYMTVLLFLLSHLYASIYTLLPAYLLLGMTLSGSAGSKAALIVHFGGKLSCSCDSQQSQAAVD 389
            :.......|:::.:|..:..:::||.:..|:..|...|:|.|.|...|  :..:..:.:||..|.
 Worm   312 LIAIFVYFLYIVINLRPTYSSMIPASIFCGIAASCIWGAKCAYITEMG--IRYASLNFESQTTVI 374

  Fly   390 VLHEEHKMFCNRDQKVRRLARWFRVSQDLGLIGGALLASILLACSDGNFTGDCSGLVYYGNESWP 454
            |                |...:|.:....|.:.|.:::|.:...|                    
 Worm   375 V----------------RFFGYFFMIVHCGQVVGNMVSSYIFTLS-------------------- 403

  Fly   455 PQLRDFYNRNEHGDRICGADMC----PLRVQSILEAGWANGSSIPSSIYAGFIESEPRVAGQSLL 515
                  |::...|......|.|    |..:..:.|...:|.:..|..:|..       |....|.
 Worm   404 ------YSQALRGPEDSIYDSCGYQFPKNLSDLTELAESNLARPPQKVYVA-------VCLAYLA 455

  Fly   516 WLYVLFSMVSLTLSLLIVVDKVQAIGSSRPERSRDVS---------------ITDTLLFAGPLAY 565
            .:.:...::|:.|:.|           ::..|:|.::               |....:...||..
 Worm   456 CVIISGMIMSMFLNAL-----------AKDARNRKMAQKFNSEIFYLMLKHLINIKFMLLVPLTI 509

  Fly   566 FVGTEQAYMMGDFLRAFVTCSLGIGMIAGALIGMGLMQLIVSCTLSMLLRHVKRIVVILAGFFFH 630
            |.|.|||:::|.:.:|||.|.|||..|...:...|:...:.|.....|::...|:.:.:.|...:
 Worm   510 FNGLEQAFLVGVYTKAFVGCGLGIWQIGFVMACFGISDAVCSLVFGPLIKLFGRMPLFVFGAVVN 574

  Fly   631 SCLLLALSSWKPSSDDSALFYVIAASWGACNGMWETLL----LSLVTLNHSSHVTEVQAPLLALR 691
            ..:::.|..|..::.|:.:|||:||.||..:|:|.|.:    ::||...      .:|......|
 Worm   575 LLMIVTLMVWPLNAADTQIFYVVAAMWGMADGVWNTQINGFWVALVGRQ------SLQFAFTKYR 633

  Fly   692 F---LGLGLTFAGHGFLCESMKIIALVVLLVISVPPYATLE 729
            |   ||:.:.||....:...:.::....:|::.:..:..:|
 Worm   634 FWESLGIAIGFALIRHVTVEIYLLITFFMLLLGMCGFLAIE 674

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3078NP_001356930.1 None
unc-93NP_001021218.1 MFS 250..673 CDD:119392 105/516 (20%)
MFS_1 250..643 CDD:284993 102/486 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334115945
eggNOG 1 0.900 E1_KOG3097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4703
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19444
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.880

Return to query results.
Submit another query.