DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and LOC100493251

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:XP_017949562.1 Gene:LOC100493251 ID: Length:467 Species:Xenopus tropicalis

Alignment Length:501 Identity:118/502 (24%)
Similarity:208/502 (41%) Gaps:85/502 (17%)


  Fly   250 RQFSCLSLAHGLMNCVLL---------PVMALQGSNAVWHHREEWLPLGPEVGSLLLSALFLVAA 305
            |...|......|.|.::|         ..|.||...:..:..|     |..|.||.:..:.|..:
 Frog     5 RSMKCAVCNENLKNILVLSFGILLLYTAYMGLQTLQSSLNKIE-----GLGVASLSVMYVSLSIS 64

  Fly   306 GMSLPSIRLMKRYGYGPLIVANYMTVLLFLLSHLYASIYTLLPAYLLLGMTLSGSAGSKAALIVH 370
            .:.||.: |:||.|....||.:....:.:.|.:.|||..||:.:.:|:|:........|:..|..
 Frog    65 SLLLPPL-LIKRIGCKWTIVLSMFCFISYSLCNFYASWPTLIISSILVGLGGGPLWAGKSTYITI 128

  Fly   371 FGGKLSCSCDSQQSQAAVDVLHEEHKMFCNRDQKVRRLARWFRVSQDLGLIGGALLASILLACSD 435
            .|.|.:    ....:.|.||:::...:|             |.:.|.. .:.|.|::|::.    
 Frog   129 IGNKYA----ETSGKLAKDVVNQYFGIF-------------FLICQTC-RVWGNLISSLIF---- 171

  Fly   436 GNFTGDCSGLVYYGNESWPPQLRDFYNRNEHGDRICGADMCPLRVQSILEAGWANGSSIPSSIYA 500
             |.:.:..||             |..|:.     :|||..||:. ||  ::|.:.||....:|. 
 Frog   172 -NLSHNSGGL-------------DALNQT-----VCGAGDCPVE-QS--QSGNSTGSQPSKTIL- 213

  Fly   501 GFIESEPRVAGQSLLWLYVLFSMVSLTLSLLIVVDKVQAIGSSRPERSRDVSITDTLLFAG---- 561
                       .:||..|....:::: |.::..:||......:|..:|: .|:...||.:.    
 Frog   214 -----------YTLLGSYTACGILAV-LMIIFFLDKPHTEKQNRENQSK-TSVCSNLLASFKQLR 265

  Fly   562 --------PLAYFVGTEQAYMMGDFLRAFVTCSLGIGMIAGALIGMGLMQLIVSCTLSMLLRHVK 618
                    ||..|.|.||.::..||.:::|||.||:..:...:|..|:...|.:.....|.::..
 Frog   266 DKRQCLLIPLTMFSGFEQGFIASDFTKSYVTCILGLKYVGFVIICFGVTNSICAAVFGKLTQYTG 330

  Fly   619 RIVVILAGFFFHSCLLLALSSWKPSSDDSALFYVIAASWGACNGMWETLLLSLVTLNHSSHVTEV 683
            ||.:.|.|...:...::...:|||...:.|:|::::..||..:.:|:|||.||..:....:....
 Frog   331 RIPLFLLGAAINVGCIIGFLTWKPHIGNFAVFFIMSGLWGIADAVWQTLLSSLYGVLFEKNKEAA 395

  Fly   684 QAPLLALRFLGLGLTFAGHGFLCESMKIIALVVLLVISVPPYATLE 729
            .|.......||..:.|....|||..:|:..|:.::||.:..|.|:|
 Frog   396 FANFSLWESLGFAIAFGYSSFLCVYVKLYILMCVVVIGILLYGTVE 441



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1145833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.