DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and LOC100487981

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:XP_017949688.1 Gene:LOC100487981 ID: Length:460 Species:Xenopus tropicalis

Alignment Length:471 Identity:110/472 (23%)
Similarity:207/472 (44%) Gaps:86/472 (18%)


  Fly   293 GSLLLSALFLVAAGMSLPSIRLMKRYGYGPLIVANYMTVLLFLLSHLYASIYTLLPAYLLLGMTL 357
            |:|::|::|       :||| |:|:.|....|.|:....:.:.|.:.|||.|||:|..|:||...
 Frog    47 GALIISSVF-------VPSI-LIKKIGLKWTIFASMCCHVTYSLGNFYASWYTLIPTSLILGFGG 103

  Fly   358 SGSAGSKAALIVHFGGKLSCSCDSQQSQAAVDVLHEEHKMFCNRDQKVRRLARWFRVSQDLGLIG 422
            :....:|...:...|.:.:    .::.:...|::::...:|             |.:.|..| :.
 Frog   104 APLWAAKCTYLTESGNRYA----EKKGKLPKDIVNQYFGLF-------------FLIFQSSG-VW 150

  Fly   423 GALLASILLACSDGNFTGDC-SGLVYYGNESWPPQLRDFYNRNEHGDRICGADMCPLRVQSILEA 486
            |.|::|::       |..|. :||    |.|:|.     |::       ||.:.||       .:
 Frog   151 GNLISSLI-------FGQDSPAGL----NNSFPD-----YSQ-------CGPNDCP-------GS 185

  Fly   487 GWANGSSIPSSIYAGFIESEPRVAGQSLLWLYVLFSMVSLTLSLLIVVDKVQAIG----SSRPER 547
            .:.||:        |.|:..     |||:::.:.....|..|:::::...:..|.    ..:|..
 Frog   186 NFGNGT--------GSIKPT-----QSLIYILLGVYTGSGVLAVILIAVFLDTINLRTDQLKPGT 237

  Fly   548 SRDVSITDTL-----------LFAGPLAYFVGTEQAYMMGDFLRAFVTCSLGIGMIAGALIGMGL 601
            ..:..|..||           ....||..:.|.||.::.||:.:::|||||||..:...:|....
 Frog   238 KEESFIKKTLATIRHLKDKRQCLLIPLTMYSGFEQGFLAGDYTKSYVTCSLGIHFVGYVMICFAA 302

  Fly   602 MQLIVSCTLSMLLRHVKRIVVILAGFFFHSCLLLALSSWKPSSDDSALFYVIAASWGACNGMWET 666
            ...:.|.....|.::..||.:.:.....::..::||..|:|..:|.|:|::..|.||..:.:|:|
 Frog   303 TNAVCSLLFGQLSKYTGRIFLFIMAAVLNAASIIALLLWQPHPNDFAVFFIFPAIWGIADAVWQT 367

  Fly   667 LLLSLVTLNHSSHVTEVQAPLLALRFLGLGLTFAGHGFLCESMKIIALVVLLVISVPPYATLE-I 730
            ...:|..:....|..|..|.......||..:.:....|||.|:|:..|:.:|:|::..|..:| :
 Frog   368 QTNALFGVLFDEHKEEAFANYCLWESLGFVIAYGYSTFLCVSIKLYILLAVLLIAIVSYGCVEYL 432

  Fly   731 RLEAQRKATLVSLXRS 746
            .....:|||..|:.::
 Frog   433 EYVEHKKATSTSISQN 448



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1145833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.