DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and unc93a

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:XP_002931523.1 Gene:unc93a XenbaseID:XB-GENE-5800507 Length:460 Species:Xenopus tropicalis

Alignment Length:471 Identity:106/472 (22%)
Similarity:204/472 (43%) Gaps:86/472 (18%)


  Fly   293 GSLLLSALFLVAAGMSLPSIRLMKRYGYGPLIVANYMTVLLFLLSHLYASIYTLLPAYLLLGMTL 357
            |:|::|::|       :||| |:|:.|....|||:....:.:.|.:.|||.|||:|..|:||...
 Frog    47 GALIISSVF-------VPSI-LIKKIGCKWTIVASMCCYITYSLGNFYASWYTLIPTSLILGFGG 103

  Fly   358 SGSAGSKAALIVHFGGKLSCSCDSQQSQAAVDVLHEEHKMFCNRDQKVRRLARWFRVSQDLGLIG 422
            :....:|...:...|.:.:    .::.:.|.|::::...:|             |.:.|..| :.
 Frog   104 APLWAAKCTYLTESGNRYA----EKKGKLAKDIVNQYFGLF-------------FLIFQSSG-VW 150

  Fly   423 GALLASILLACSDGNFTGDCSGLVYYGNESWPPQLRDFYNRNEHGDRICGADMCPLRVQSILEAG 487
            |.|::|::                 :|.:| |....:.:....|    |||:.||       .:.
 Frog   151 GNLISSLI-----------------FGQDS-PAGSNNSFPDYSH----CGANDCP-------GSN 186

  Fly   488 WANGSS----IPSSIYAGFIESEPRVAGQSLLWLYVLFSMVSLTLSLLIVVDKVQAIGSSRPERS 548
            :.||:.    ..|.||             :||.:|....::::.| :.:.:|.:..........:
 Frog   187 FGNGTGSIKPTQSLIY-------------TLLGVYTGSGVLAVIL-IAVFLDTINLRTDQLKPGT 237

  Fly   549 RDVSITDTLL------------FAGPLAYFVGTEQAYMMGDFLRAFVTCSLGIGMIAGALIGMGL 601
            ::.|....:|            ...||..:.|.||.::.||:.:::|||||||..:...:|....
 Frog   238 KEESFIKKILATIRHLKDKRQCLLIPLTMYSGFEQGFLAGDYTKSYVTCSLGIHFVGYVMICFAA 302

  Fly   602 MQLIVSCTLSMLLRHVKRIVVILAGFFFHSCLLLALSSWKPSSDDSALFYVIAASWGACNGMWET 666
            ...:.|.....|.::..||.:.:.....::..::||..|:|..:|.|:|::..|.||..:.:|:|
 Frog   303 TNAVCSLLFGQLSKYTGRIFLFIMAAVLNAASIIALLLWQPHPNDFAVFFIFPAIWGIADAVWQT 367

  Fly   667 LLLSLVTLNHSSHVTEVQAPLLALRFLGLGLTFAGHGFLCESMKIIALVVLLVISVPPYATLE-I 730
            ...:|..:....|.....|.......||..:.:....|||.|:|:..|:.:|:|::..|..:| :
 Frog   368 QTNALYGVLFDEHKEAAFANYRLWESLGFVIAYGYSTFLCVSIKLYILLAVLLIAIVLYGCVEYL 432

  Fly   731 RLEAQRKATLVSLXRS 746
            .....:|||..|:.::
 Frog   433 EYVEHKKATSTSISQN 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3078NP_001356930.1 None
unc93aXP_002931523.1 MFS_1 7..399 CDD:284993 92/421 (22%)
MFS 10..168 CDD:304372 38/165 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C335085211
eggNOG 1 0.900 E1_KOG3097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1145833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.