DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and unc93b1

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:XP_012815862.1 Gene:unc93b1 XenbaseID:XB-GENE-492943 Length:604 Species:Xenopus tropicalis

Alignment Length:527 Identity:107/528 (20%)
Similarity:206/528 (39%) Gaps:120/528 (23%)


  Fly   256 SLAHGLMNCVLLPVMALQGSNAVWHHREEWLPLG-PEVGSLLLSALFLVAAGMSLPSIRLMKRYG 319
            ||...|...|.|.::.:|   .:.|:.|.:..:. ..:|...:.:..|:...:: |.:.|:    
 Frog    81 SLGAALTYGVYLGLLQMQ---LILHYDETYRDVKYSNIGLQDIDSKMLMGINVT-PIVALL---- 137

  Fly   320 YGPLIVANYMTV-LLFLLSHLYA---------SIYTLLPAYLLLGMTLSGSAGSKAALIVHFGGK 374
            |.|:::..:.|. ::||.|.:||         ..|||:|:..::|:           :||.|...
 Frog   138 YTPVLIRFFGTKWMMFLSSGIYALFVSTNYWERYYTLVPSATVIGV-----------MIVPFWAS 191

  Fly   375 LSCSCDSQQSQAAVDVLHEEHKMFCN-RDQKVRRLARWFRVSQDLGLIGGALLASILLACSDGNF 438
            |.         ..:..:.:::..|.| :::.||...|..|.:....:|   :..||..:....:|
 Frog   192 LG---------NYITRMAQKYYEFVNYKEENVREQRRVPRGASHRYII---IFQSIFYSLFHISF 244

  Fly   439 TGDCSGLVYYGNESWPPQLRDF---YNRNEHGDRICGA----DMCPLRVQSILEAGWANGSSIPS 496
            ......:.::        |..|   ||......|.|||    .:.|....::|.       ::|.
 Frog   245 VLAQLPVHFF--------LSKFFYSYNHTLFNVRDCGAAIQHGILPNFNLTVLH-------TLPP 294

  Fly   497 SIYAGFIESEPRVAGQSLLWLYVLFSMVSLTLSLLIVVDKVQAIGSS-RPERSRDV-SITDTLLF 559
            |:...::||  .:.|.:|         ||:.|.||:       .||: ||....|: ||....:|
 Frog   295 SLNLIYVES--ALMGAAL---------VSMLLILLL-------CGSAYRPTEEIDLRSIGWGNIF 341

  Fly   560 AGPL------------AYFV--GTEQAYMMGDFLRAFVTCSLGIGMIAGALIGMGLMQLIVSCTL 610
            ..|.            .||:  |.|..:....|...:..||||:..:...|...|: ....|.:|
 Frog   342 QLPFKHARDYRLRCLAPYFLYSGFEVLFACTCFALCYGVCSLGLESLPFLLTAYGI-SASFSSSL 405

  Fly   611 SMLLRHVKRIVVILAGFFFHSCLLLALSSWKPS---SDDSALFYVIAASWGACNGMWETLLLSLV 672
            ::.:....|.:.::.|...|.|:|:.|..|.|:   .....|.|::|..||..:.:.::.|..::
 Frog   406 ALCMLRFPRQIPLVGGTLLHCCILIGLFFWSPTPKLQSQKPLLYLVAILWGVGSALNKSGLSIII 470

  Fly   673 TLNHSSHVTE---------VQAPLLALRFLGLGLTFAGHGFLCESMKIIALVVLLVISVPPYATL 728
            .:.:.....:         :||..:.:.:|..|:..        :.|:..::...:|||..|..:
 Frog   471 GVFYEDKERQDFVFTIYHWLQALAIFIVYLWSGIPV--------TAKLGIMLASALISVLSYLWM 527

  Fly   729 EIRLEAQ 735
            |.:|..:
 Frog   528 EHKLSCK 534



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C335115639
eggNOG 1 0.900 E1_KOG3097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.