DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3078 and unc93b1

Sequence 1:NP_001356930.1 Gene:CG3078 FlyBaseID:FBgn0023524 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_001275745.1 Gene:unc93b1 ZFINID:ZDB-GENE-130424-1 Length:623 Species:Danio rerio

Alignment Length:525 Identity:106/526 (20%)
Similarity:195/526 (37%) Gaps:152/526 (29%)


  Fly   288 LGPEVGSLLLSALFLVAAGMSLPSIRLMKRYG-------YG------------------PLIVAN 327
            :|...|.:::.:::     |.|..::|:..|.       ||                  |::...
Zfish    73 VGASCGGMIIYSVY-----MGLLQMQLILHYDETYREVKYGTLGLEDIDNKMLMGINVTPIVGLL 132

  Fly   328 YMTVL---------LFLLSHLYA---------SIYTLLPAYLLLGMTLSGSAGSKAALIVHFGGK 374
            |..||         :||.|.:||         ..|||:|:.:.:|:.:.....|....|..    
Zfish   133 YTPVLIRFLGTKWMMFLASGIYALFVSTNYWERYYTLVPSAVAIGVVIVPLWASMGNYITR---- 193

  Fly   375 LSCSCDSQQSQAAVDVLHEEHKMFCN-RDQKVRRLARWFRVSQDLGLIGGALLASILLACSDGNF 438
                            :.:::..|.| :|:.|:...:..:         ||..:.|::..|    
Zfish   194 ----------------MAQQYYEFVNYKDENVQEQKKPPK---------GAFHSYIIIFQS---- 229

  Fly   439 TGDCSGLVYY-------GNESWPPQLRDFYNR--NEHGDRICGADMCPLRVQSILEAGWANGS-- 492
                   |:|       ....:|..|  |.|.  |::...:.....|....:.::|    |.:  
Zfish   230 -------VFYIIFHLSFVFAEFPTVL--FLNNYLNDYRHTLFKVSQCGAGGKGVIE----NFNKT 281

  Fly   493 ---SIPSSIYAGFIESEPRVAGQSLLWLYVLFSMVSLTLSLLIVVDKVQAIGSSR----P-ERSR 549
               |:|.|:.  .||.|..:.|.:.|.:.:...:..........:| :::||...    | :..|
Zfish   282 VLKSLPRSLL--LIEVESALMGAAFLSMLIFLLLCGAAYRPTEEID-LRSIGWGNIFQLPFKHLR 343

  Fly   550 DVSITDTLLFAGPLAYFVGTEQAYMMGDFLRAFVTCSLGIGMIAGALIGMGLMQLIVSCTLSMLL 614
            |..|  .||.  |...:.|.|..:.:.....::..|::|:..:...::..||...|.| .|::.|
Zfish   344 DYRI--RLLC--PFFIYSGFEVLFAVQGLTLSYGVCAVGMEKLWLLVMVYGLSSSICS-ALALAL 403

  Fly   615 RHVKRIVVILAGFFFHSCLLLALSSWKPS-SDDSALFY--VIAASWGACNGMWETLLLSLV---- 672
            ..:.|.|::|||.|.|..|::||..|.|: .|.|.|.|  |::|.||....:.:|.|.:|:    
Zfish   404 LRLPRPVILLAGAFVHFVLIIALMCWSPTPRDTSRLPYLLVVSALWGLGTALNKTGLSTLLGMLY 468

  Fly   673 ----------TLNHSSHVTEVQAPLLALRFLGLGLTFAGHGFLCESMKIIALVVLLVISVPPYAT 727
                      |:.|     ..||..:.:.:|...|....        |:..|::.|:::...|..
Zfish   469 EDKERLDFVYTIYH-----WWQAIAIFIVYLWSALPMRA--------KLGLLLLTLLVASLCYVQ 520

  Fly   728 LEIRL 732
            :|.||
Zfish   521 MERRL 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3078NP_001356930.1 None
unc93b1NP_001275745.1 MFS <132..>192 CDD:328737 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C335099358
eggNOG 1 0.900 E1_KOG3097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.