DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ph-p and Samd1

Sequence 1:NP_476871.2 Gene:ph-p FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:NP_001074884.1 Gene:Samd1 MGIID:2142433 Length:519 Species:Mus musculus

Alignment Length:546 Identity:116/547 (21%)
Similarity:159/547 (29%) Gaps:202/547 (37%)


  Fly  1060 PQG-----PPSLTPTTNPILAMTSMMNATVGHLSTAPPVTVSVTSTAVTSSPGQLVLLSTASSGG 1119
            |:|     ||:..|...|:.|.|....|..   :||||            |||            
Mouse   115 PRGGPAAPPPTPAPPPAPVAAPTRAPRAAA---ATAPP------------SPG------------ 152

  Fly  1120 GGSIPATPTKETPSKGPTATLVPIGSPKTPVSGKDTCTTPKSSTPATVSASVEASSSTGEALSNG 1184
                ||.|........|.|  .|..:|..|         |.::.||                   
Mouse   153 ----PAQPGPRAQRAAPLA--APPPAPAAP---------PAAAPPA------------------- 183

  Fly  1185 DASDRSSTPSKGATTPTSKQSNAAVQPPSSTTPNSVSGKEEPKLATCGSLTSATSTSTTTTITNG 1249
             ...|:..|:..|..|.:........||....|      .|...|..|......|.........|
Mouse   184 -GPRRAPPPAVAAREPPAPPQQQQPPPPQPQPP------PEGGAARAGGPARPVSLREVVRYLGG 241

  Fly  1250 IGVARTTASTAVSTASTTTTSSGTFITSCTSTTTTTTSSISNGSKDLPKAMIKPNVLTHVIDGFI 1314
            .|.|        |...|.....|.............|..   |:..||:.               
Mouse   242 SGGA--------SGRLTRGRVQGLLEEEAARGRLERTRL---GALALPRG--------------- 280

  Fly  1315 IQEANEPFPVTRQRYA-----------DKDVSDEPPKKKATMQEDIKLSGIASAPGSDMVACEQ- 1367
             .......|....|.|           :|:..||...::.  :|:..:|..:..|.||..|..| 
Mouse   281 -DRPGRAPPAASARAARSKRGGEERVFEKEEEDEDEDEEE--EEEDNVSEGSEVPESDRPAGAQH 342

  Fly  1368 ------CGKMEHKAKLKRKRYCSPGCSRQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRLDEA 1426
                  .|....|.::|....|.|             ..|:..|.|                   
Mouse   343 HQINGERGPQSAKERVKEWSPCGP-------------YQGQDEGRG------------------- 375

  Fly  1427 MAEEKMQTEATPKLSESFPILGAST-EVPPM--------SLPVQAAISAPSPLAMPLGSPLSVAL 1482
                              |..|:.| :|.||        |..|.||..:|||:.:|.|.|   ||
Mouse   376 ------------------PAPGSCTRQVFPMTAVNKEGGSACVGAAPDSPSPVPLPPGKP---AL 419

  Fly  1483 PTLAPLSVVTSGA------APKSSEVNGTDRPPISSWSVDDVSNFIRELPGCQDYVDDFIQQEID 1541
            |          ||      .|...:...||  |: .|:|.||..:..| .|..:....|.:||||
Mouse   420 P----------GADGTPFGCPPGRKEKPTD--PV-EWTVMDVVEYFTE-AGFPEQATAFQEQEID 470

  Fly  1542 GQALLLLKEKHLVNAMGMKLGPALKI 1567
            |::|||::...::..:.::|||||||
Mouse   471 GKSLLLMQRTDVLTGLSIRLGPALKI 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 23/61 (38%)
SAM 1511..1576 CDD:197735 22/58 (38%)
Samd1NP_001074884.1 SAM_Atherin-like 440..508 CDD:188982 23/60 (38%)
SAM 440..506 CDD:197735 23/60 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.