DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ph-p and phc3

Sequence 1:NP_476871.2 Gene:ph-p FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:XP_009296927.1 Gene:phc3 ZFINID:ZDB-GENE-070912-369 Length:890 Species:Danio rerio

Alignment Length:1004 Identity:236/1005 (23%)
Similarity:362/1005 (36%) Gaps:298/1005 (30%)


  Fly   739 VNAAGNKMVVMSTTGTPITLQNGQTLHAATAAGVDKQQQQLQLFQKQQILQQQQM----LQQQIA 799
            |..|...:...:.|||.|.|.|           :...:|.:|:.| |.:.:.|.|    |||..|
Zfish    18 VTTASTTVTSTTPTGTSIPLGN-----------ISSDRQAVQVIQ-QTLHRPQSMTAQYLQQMYA 70

  Fly   800 AIQMQ--QQQAAVQAQQQQQQQVSQQQQVNAQQQQAVAQQQQAVAQAQQQQREQQQQVAQAQAQH 862
            |.|..  .|.||:|.|||.||.::..|.:......|              |....|.::...:.|
Zfish    71 AQQQHILLQTAALQQQQQHQQNLTAAQILTTTDTAA--------------QTNGSQFISSPSSSH 121

  Fly   863 QQA--LANATQQILQVAPNQFITSHQQQQQQQLHNQ---LIQQQ---LQQQAQAQVQAQVQAQAQ 919
            ...  |||.||..:.: |...:|....:.|....:.   .|.||   |...:....|||:..:.|
Zfish   122 GNGPQLANVTQTSIPI-PTSPVTQPMARIQVTSSSSTGGAISQQAMLLGNSSPTGSQAQMYLRTQ 185

  Fly   920 QQQQQREQQQNIIQQIVVQQSGATSQQTSQQQQHHQSGQLQLSSVPFSVSSST-TPAGIATSSAL 983
            ............:|..:...|..:||..|.|.|              |::..| .|..:.||..:
Zfish   186 MLILTPAATVAAVQPDLTVVSSISSQSASSQVQ--------------SLALRTHLPGALTTSQNI 236

  Fly   984 QAALSASGAIFQTAKP--GTC---SSSSP-----TSSVVTITNQ-----SSTPLVTSSTVASIQQ 1033
            |......|....:..|  ..|   |:..|     ||..|::.|.     |:.|.:..||...:|.
Zfish   237 QIKPPLQGQTLVSPPPKMSICPLKSTQLPQNLVETSRSVSVLNNVTQTPSAQPAIPPSTFTPVQS 301

  Fly  1034 AQTQSAQVH-------------------QHQQLISATIAGGTQQQPQGPPSL----TPTT----- 1070
            .|....|:|                   .|:||...|:....|.....|.:|    ||||     
Zfish   302 HQLIRHQLHCPSGPRVAPQHLIIQQSSSTHRQLHPITLRVTAQDGSPTPFTLHTRTTPTTATVQS 366

  Fly  1071 --NPILAMTSMMNATVGHLS-TAPPVTVSVTSTAVTSSPGQLVLLSTASSGGGGSIPATPTKETP 1132
              ..:|::.|..|.|..... |:||        ||...|..|.|         |......::.||
Zfish   367 QQTELLSVPSSTNQTANQTKYTSPP--------AVLPDPPPLHL---------GPALEPVSQYTP 414

  Fly  1133 SKGP--------------TATLVPIGSPKTPVSGKDTCTT------PKSSTPATVSASV------ 1171
            ...|              :...|.:.|..|.:|.::...|      |..|.|...:.:|      
Zfish   415 LSCPPPLKLVQPQRLALRSVQAVEVQSDHTLLSEEELPLTEAVLQLPFQSLPPPQTVAVDLKVQP 479

  Fly  1172 ----EASSST----GEALSNGDASDRSSTP--SKGATTPTSKQSNAAVQPPSST------TPNSV 1220
                |||..|    .|.|:....::.:|.|  |:.:::||..||:   :|..|:      ..|..
Zfish   480 ATQTEASQVTPLLESENLTLVTDAEHASPPQNSRTSSSPTLSQSD---EPQRSSDVVTDQPENLT 541

  Fly  1221 SGKEEPKLATCGSLTSATSTSTTTTITNGIGVARTTASTAVSTASTTTTSSGTFITSCTSTTTTT 1285
            :.:|:|.:.:..|:..:....|..|         ::.|..:|:|             ..|::..:
Zfish   542 ADQEQPCVPSSRSVIRSPEEPTHAT---------SSPSPLLSSA-------------VRSSSRLS 584

  Fly  1286 TSSISNGSKDLP-KAMIKPNVLTHVIDGFIIQEANEPFPVTR----------------------- 1326
            ::|:....:..| :|:.:|::|||:|:||:|:|..|||||..                       
Zfish   585 SASLPESPEGRPSQAISRPHILTHLIEGFVIREGLEPFPVRHVSLEMNLQATLPENREDGESALI 649

  Fly  1327 -----QRYADKDVSDEPPKKKATMQEDIKLSGIASAPGSDMVACEQCGKME-HKAKLKRKRYCSP 1385
                 ...:|.|:.|.|.:.:.|::   ||        .:::.||.|||.. .:|.|:.||:||.
Zfish   650 DADHPDSSSDSDIDDPPAEDEQTVE---KL--------PEVLECEFCGKRGLAQAFLRSKRFCSM 703

  Fly  1386 GCSRQ----------------------AKNGIGGVGSGETNGLGTGGIVGVDAMALVDRLDEAMA 1428
            .|:|:                      ...|..|..|...||            :..:.|.....
Zfish   704 TCARRFNLRCKKRLNRLREEKVTYWPHRSMGKRGRPSRCLNG------------SAREHLPRPQL 756

  Fly  1429 EEKMQTEATPKLSESFPILGASTEVPPMSLPVQAAISA-----------PSPLAMPLGSPLSVAL 1482
            :...|......:|.|..:.....|.||..:..:..:.|           .|.:....||.|.:  
Zfish   757 QGSHQASDNQMVSNSVWMEREEEEDPPGPMTTRLRLQAEREKEQNREQEQSRVESSSGSELLL-- 819

  Fly  1483 PTLAPLSVVTSGAAPKSSEVNGTDRPPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLL 1547
                                   |..| |.|||:.|.:||..||||.|...:|..||||||||||
Zfish   820 -----------------------DSSP-SQWSVEQVCSFISTLPGCHDVAAEFGCQEIDGQALLL 860

  Fly  1548 LKEKHLVNAMGMKLGPALKIVAKVESIKE 1576
            |.|.||::||.:||||||||.|.:.::|:
Zfish   861 LTEDHLMSAMNLKLGPALKICAHINTLKQ 889

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 40/68 (59%)
SAM 1511..1576 CDD:197735 39/65 (60%)
phc3XP_009296927.1 SAM_Ph1,2,3 821..889 CDD:188976 40/69 (58%)
SAM 823..890 CDD:197735 40/69 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JS2
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128665
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4720
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.