DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ph-p and si:ch211-230g15.5

Sequence 1:NP_476871.2 Gene:ph-p FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:XP_017209418.1 Gene:si:ch211-230g15.5 ZFINID:ZDB-GENE-091204-280 Length:960 Species:Danio rerio

Alignment Length:1141 Identity:253/1142 (22%)
Similarity:390/1142 (34%) Gaps:363/1142 (32%)


  Fly   570 NQPDGTQGMFIQQQPATQTLQTQQNQ-------IIQCNVTQTPTKARTQLDALAP--KQQQQQQQ 625
            :|.:||.    :..||..|:.|..||       ::|.|::.         |.|||  ...::..|
Zfish    46 HQANGTP----KTPPALTTVTTFHNQPSPTNRKVVQINLSG---------DRLAPSFSPSERVSQ 97

  Fly   626 VGTTNQTQQQQLAVATAQLQQQQQQLTAAALQRPGAPVMPHNG----TQVRPAS------SVSTQ 680
            ..::.||.:                 |.:....||:..:...|    |.||..|      ..|..
Zfish    98 ASSSQQTPK-----------------TISLPNTPGSTALVRGGQSAVTAVRKISPQTLLLGKSPS 145

  Fly   681 TAQNQSLLKAKMRNKQQPVRPALATLKTEIGQVAGQNKVVGHLTTVQQQQQ----ATNLQQVVNA 741
            |:|.|.||:|:|......|||.:..|.:.....:..:......::......    :|.||.:.  
Zfish   146 TSQAQMLLRAQMLILTSAVRPDVPALSSSFSSSSSFSSSSSSSSSTPSSSSPRFPSTQLQSLT-- 208

  Fly   742 AGNKMVVMSTTGTPITLQNGQTLHAATAAGVDKQQQQLQLFQKQQILQQQQMLQQQIAAIQMQQQ 806
                 :.....|| :|:.....|...|::                  |...:...:|....::..
Zfish   209 -----IRPPPPGT-LTIPPNLPLKPTTSS------------------QPPPLSCPRIPTFHLRPS 249

  Fly   807 QAAVQAQQQQQQQVSQQQQVNAQQQQAVAQQQQAVAQAQQQQREQQQQVAQAQAQHQQALANATQ 871
            |.|                 ||..:....:.:...:|..|.:...:.......:.:..|.|:|  
Zfish   250 QPA-----------------NAPGKDGATKSESPTSQTAQTKTPVRHLTVPPPSLYAPAQAHA-- 295

  Fly   872 QILQVAPNQFITSHQQQQQQQLHNQLIQQQLQQQAQAQVQAQVQAQAQQQQQQREQQQNIIQQIV 936
                                     |.:|:|...:..:..:|:.. .|....||....|      
Zfish   296 -------------------------LAKQKLNSSSLKRPHSQISI-PQHPFNQRHTPPN------ 328

  Fly   937 VQQSGATSQQTSQQQQHHQSGQLQLSSVPFSVSSSTTPAGIATSSALQAALSASGAIFQTAKPGT 1001
              ...||.::...:.:...|.|...|..|.|.|.|     |...|..:|.|:          |.|
Zfish   329 --SPPATPKKPLPELKRCPSTQASQSISPQSASVS-----ITVPSPARAHLT----------PPT 376

  Fly  1002 CS----SSSPTSSVVTITNQSSTPLVTSSTVASIQQAQTQSAQVH------QHQQLISATIAGGT 1056
            .:    ||||..|:  :..:....:..||..|.....|:::|.|.      |.:.|:|..:|   
Zfish   377 LTLPLRSSSPGGSL--LATKQLLRIALSSASAQCTNGQSKTATVSPPHDLIQSKPLLSPVLA--- 436

  Fly  1057 QQQPQGP--PSLTPTTNPILAMTSMMNATVGHLSTAPPVTVSVTSTAVTSSPGQLVLLSTASSGG 1119
              :|:.|  |.|||.|.|.|...|....|.   :..|.:|....::...:||...||...::|  
Zfish   437 --KPECPTQPLLTPNTCPQLVQLSPSRQTT---AATPLITTPPLASPQRASPPSPVLPLVSTS-- 494

  Fly  1120 GGSIPATPTKETPSKGPTATLVPIGSPKTPVSGKDTCTTPKSSTPATVSASVEASSSTGEALSNG 1184
              ||.|.|.....|:.||.....:..||.....:...|.|: .||..:.                
Zfish   495 --SILAPPQSPLTSQSPTQITETLKEPKDRKEEQKQGTVPE-QTPQDLK---------------- 540

  Fly  1185 DASDRSSTPSKGATTPTSKQSNAAVQPPSSTTPNSVSGKEEPKLATC--GSLTSATSTSTTTTIT 1247
                        ...|..|.:.|..|.||     ..|.|...|:..|  .|.|.....::....|
Zfish   541 ------------CPAPQKKMTQAVDQLPS-----EASEKVLNKIIVCTENSRTDGQIKTSQKNET 588

  Fly  1248 NGIGVARTTASTAVSTASTTTTSSG-TFITSCTSTTTTTTSSIS--------------------- 1290
            :...||...|........|:|.|.. :.|:|.:|..:...|||:                     
Zfish   589 HSPSVAPWPAEKDDQCEETSTQSDNHSAISSLSSDMSPIQSSIAQPLDMSPVDSCFPPKFHPVLE 653

  Fly  1291 ---------NGSKDL----PKAMIKPNVLTHVIDGFIIQEANEPFPVTRQRYADKDVSD------ 1336
                     :..||.    .....||.||||:::||||||..|||||:|.......|.|      
Zfish   654 RPLVQSSTLSQMKDTEGQQASGAPKPLVLTHLVEGFIIQEGLEPFPVSRSSLMVGPVQDSGVNGV 718

  Fly  1337 ----------EPPKKKATMQEDIKLSGIASAPGSD-----MVACEQCGKMEHKAKL--KRKRYCS 1384
                      |.|:......::   .|:|::.|..     ::.|:.| |.:..|:.  :.||:||
Zfish   719 KEPGLIPSGSEHPEDSTDSDDE---DGVANSNGVGRAHKLVLQCQFC-KRKGTAQTFPRSKRFCS 779

  Fly  1385 PGCSRQAKN-----------GIGGVGSGETNGLGTGGIVGVDAMALVDRLDEAMAEEKMQTEATP 1438
            ..|:::...           ..||..| |.||                      ||:... :|..
Zfish   780 KSCAKRFSYTKRFRALRRCVSEGGHRS-ELNG----------------------AEDSFH-QAKH 820

  Fly  1439 KLSESFPILGASTEVPPM------SLPVQAAI----------------------SAPSPLAMPLG 1475
            ..:|.:.||    :.||.      |.|::..:                      |||:       
Zfish   821 GATEQWRIL----QQPPQEGEDGTSAPMKTRLRRHTEQEREREIRVRHTVEETRSAPT------- 874

  Fly  1476 SPLSVALPTLAPLSVVTSGAAPKSSEVNGTDRPPISSWSVDDVSNFIRELPGCQDYVDDFIQQEI 1540
            ||:....||                  :.|..|..:.|:||.||:||.:||||||..:.|..|||
Zfish   875 SPIDPVSPT------------------DITPYPKPAQWTVDQVSSFISKLPGCQDIAESFRAQEI 921

  Fly  1541 DGQALLLLKEKHLVNAMGMKLGPALKIVAKVESIKE 1576
            ||||||||.|.||::||.:||||||||.|::.|::|
Zfish   922 DGQALLLLTEDHLMSAMNVKLGPALKICARINSLRE 957

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 41/68 (60%)
SAM 1511..1576 CDD:197735 40/65 (62%)
si:ch211-230g15.5XP_017209418.1 SAM_Ph1,2,3 889..957 CDD:188976 41/68 (60%)
SAM 891..957 CDD:197735 40/66 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JS2
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.