DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ph-p and sfmbt2

Sequence 1:NP_476871.2 Gene:ph-p FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:XP_005164891.1 Gene:sfmbt2 ZFINID:ZDB-GENE-041210-196 Length:861 Species:Danio rerio

Alignment Length:766 Identity:157/767 (20%)
Similarity:240/767 (31%) Gaps:233/767 (30%)


  Fly   950 QQQHHQSGQLQLSSV----------PFSVSSSTTPAGIATSSALQAALSASGAIFQTAKPGT--C 1002
            |.|.:..|:|.||.|          .|.:.:...|.|.|..:.|            ..||.|  |
Zfish   180 QVQRNVGGRLCLSYVGLNDPSYYMWMFYLDTRLRPLGWAKENNL------------PMKPPTDLC 232

  Fly  1003 ---SSSSPTSSVVTITNQS-STPLVTSSTVASIQQAQTQSAQVHQHQ-------QLISATIAGGT 1056
               |||..|:::...|.:: :.||..        :.....|.:|.|.       :::|       
Zfish   233 DLRSSSEWTTALDEATAEALNNPLPL--------EVFKDHADLHTHSFRAGMKLEMVS------- 282

  Fly  1057 QQQPQGPPSLTPTTNPILAMTSMMNATVGHLS-TAPPVTVSVTSTAV---TSSPGQLVLLSTASS 1117
               |..|..:.|     :::|.:.|..  |.. |...:|...|.|:.   ..|||.|.:.....:
Zfish   283 ---PVEPFHICP-----VSVTKVYNEY--HFQITVDDLTADATPTSAVCHAESPGILPVQWCLKN 337

  Fly  1118 GGGGSIP----------ATPTKETPSKGPTATLVPIGSPK------------TPVSGKDTCTTP- 1159
            |.....|          |...|.|.::.......|..|..            .|:...:.|... 
Zfish   338 GVELERPRGFETQDFDWADYLKHTSTEAAPDACFPNASQSRGFCKDMWLEAVNPLHPAELCVARI 402

  Fly  1160 ------------KSSTPATVSASVEASS----STGEALSNGDASDRSSTPSKGATTPTSKQSNAA 1208
                        :..|.......|:..|    ..|...:||.....|   .|....|..|  .|.
Zfish   403 TQVKGCLLWLRLEGLTKPLPDCIVDVESMNIFPVGWCEANGYPLTHS---LKTVCLPQKK--IAV 462

  Fly  1209 VQPPSSTTPNSVSGKEEPKLATCGSLTSATSTSTTTTITNGIGVARTTASTAVSTASTTTTSSGT 1273
            |||.....|:     :.|.:    .::..:|....:.:.||                 ....|..
Zfish   463 VQPEKQLAPS-----QSPDI----PISLCSSAPMDSGLVNG-----------------KYCCSQL 501

  Fly  1274 FIT-SCTSTTTTTTSSISNGSKDLPK-------AMIKPNVLTHVIDGFIIQEANEPFPVTR--QR 1328
            ||. .|.|........|:    :|||       |::...:||     .:|..|.:|..|.|  |.
Zfish   502 FINHRCFSGPYLNKGRIA----ELPKAVGPGKCAVVLKEILT-----MLINSAYKPGRVLRELQM 557

  Fly  1329 YADKDVSDEPPKKKATMQEDIKLSGIASAPGSDMVA--CEQ-CGKMEHKAKLKRKRY----CSPG 1386
            ..|...:.:....||..:.....|.:.....:|.|:  |.: |.:::....|....:    |...
Zfish   558 VEDPQWNCQEETLKAKYKGKSYRSTMRIVRTADQVSEFCRRVCERLQCCLNLFGPTFVSDKCPEN 622

  Fly  1387 CSRQA--------KNGIGGVGSGETNGLG---------------------TGGIVGV-------D 1415
            ||.|.        |..:|....||....|                     ...|||.       |
Zfish   623 CSSQTKTKYTYYKKRKVGRPSLGENAQDGDLSKPARRRKKRKAIFVQKKRRSSIVGYHTTESPQD 687

  Fly  1416 AMALVDRLDEAMAEEKMQTEATPKLSE------SFPILGASTEVPPMSLPVQAAISAPSPLAMPL 1474
            :....|..::...||.....::..|.|      |.|..|.    ||....:|..::.|       
Zfish   688 SDYNYDEDEDEDFEEWGSEASSSSLREEASAHNSLPRRGR----PPRRAALQRRMTHP------- 741

  Fly  1475 GSPLSVALPTLAPLSVVTSGAAPKSSEVNGT---------------DRPPISSWSVDDVSNFIRE 1524
            ||..|   ..::|.....|.:..::.....|               |..|: .|||.||.:||..
Zfish   742 GSETS---DRISPRRTTRSVSYSQNQMARDTNVKMESTEEEDRLVLDTNPL-QWSVSDVVDFITS 802

  Fly  1525 LPGCQDYVDDFIQQEIDGQALLLLKEKHLVNAMGMKLGPALKIVAKVESIK 1575
             ..|......|.:|:|||||||||....:...|.:|||||:|:..::|.:|
Zfish   803 -TDCASLAKIFQEQDIDGQALLLLTLPTVQECMDLKLGPAIKLCHQIERVK 852

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 29/69 (42%)
SAM 1511..1576 CDD:197735 28/66 (42%)
sfmbt2XP_005164891.1 MBT 13..110 CDD:214723
MBT 134..228 CDD:302657 14/60 (23%)
MBT 277..348 CDD:280910 17/88 (19%)
MBT 356..447 CDD:214723 12/91 (13%)
DUF3588 498..612 CDD:288954 27/123 (22%)
SAM_Scm-like-4MBT1,2 777..861 CDD:188980 30/79 (38%)
SAM 788..852 CDD:197735 28/66 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.