DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ph-p and ph-d

Sequence 1:NP_476871.2 Gene:ph-p FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:NP_524794.2 Gene:ph-d FlyBaseID:FBgn0004860 Length:1537 Species:Drosophila melanogaster

Alignment Length:1594 Identity:1352/1595 (85%)
Similarity:1395/1595 (87%) Gaps:94/1595 (6%)


  Fly    14 DTESDTTTPVSTTASQGISASAILAGGTLPLKDNSNIREKPLHHNYNHNNNNSSQHSHSHQQQQQ 78
            ||||::.|.:.|...   |..|     |..:|.||..|..|                        
  Fly    16 DTESESATTIRTPPP---SPEA-----TTSVKVNSTTRVDP------------------------ 48

  Fly    79 QQVGGKQLERPLKCLETLAQKAGITFDEKYDVASPPHPGIAQQQATSGTGPATGSGSVTPTSHRH 143
                    :|||:|||||||||||:|||  |.|..|....:.:.|         .|||       
  Fly    49 --------QRPLRCLETLAQKAGISFDE--DFAKSPSQSPSSKAA---------RGSV------- 87

  Fly   144 GTPPTGRRQTHTPSTPNRPSAPSTPNTNCNSIARHTSLTLEKAQNPGQQVAATTTVPLQISPEQL 208
            |||...||....|.:...||||.         ::.|...|||:|:|.|||||.|.||||||||||
  Fly    88 GTPSIRRRHPLLPLSSRSPSAPD---------SKTTGRKLEKSQSPAQQVAAATNVPLQISPEQL 143

  Fly   209 QQFYASNPYAIQVKQEFPTHTTSGSGTELKHATNIMEVQQQLQLQQQLSEANGGGAASAGAGGAA 273
            ||.||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   144 QQLYANNPYAIQVKQEFPTHTTSGSGTELKHATNIMEVQQQLQLQQQLSEANGGGAASAGAGGAA 208

  Fly   274 SPANSQQSQQQQHSTAISTMSPMQLAAATGGVGGDWTQGRTVQLMQPSTSFLYPQMIVSGNLLHP 338
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   209 SPANSQQSQQQQHSTAISTMSPMQLAAATGGVGGDWTQGRTVQLMQPSTSFLYPQMIVSGNLLHP 273

  Fly   339 GGLGQQPIQVITAGKPFQGNGPQMLTTTTQNAKQMIGGQAGFAGGNYATCIPTNHNQSPQTVLFS 403
            ||||||||||||||||||||||||||||||||||||||||||||||||||||:||||||||||.|
  Fly   274 GGLGQQPIQVITAGKPFQGNGPQMLTTTTQNAKQMIGGQAGFAGGNYATCIPSNHNQSPQTVLIS 338

  Fly   404 PMNVI--SPQQQQNLLQSMAAAAQQQQLTQQQQQFNQQQQQQLT--QQQQQLTAALAKVGVDAQG 464
            |:|||  |||||||||||||||||||||||||||...||||||.  |||||||||||||||||||
  Fly   339 PVNVISHSPQQQQNLLQSMAAAAQQQQLTQQQQQQLNQQQQQLNQQQQQQQLTAALAKVGVDAQG 403

  Fly   465 KLAQKVVQKVTTTSSAVQAATGPGSTGSTQTQQVQQVQQQQQQTTQTTQQCVQVSQSTLPVGVGG 529
            |||||||||||||||.|||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   404 KLAQKVVQKVTTTSSTVQAATGPGSTGSTQTQQVQQVQQQQQQTTQTTQQCVQVSQSTLPVGVGG 468

  Fly   530 QSVQTAQLLNAGQAQQMQIPWFLQNAAGLQPFGPNQIILRNQPDGTQGMFIQQQPATQTLQTQQN 594
            ||||||||||||||||||||||.||||||||||.|||||||||||||||||||||||||||||||
  Fly   469 QSVQTAQLLNAGQAQQMQIPWFWQNAAGLQPFGSNQIILRNQPDGTQGMFIQQQPATQTLQTQQN 533

  Fly   595 QIIQCNVTQTPTKARTQLDALAPKQQQQQQQVGTTNQTQQQQLAVATAQLQQQQQQLTAAALQRP 659
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   534 QIIQCNVTQTPTKARTQLDALAPKQQQQQQQVGTTNQTQQQQLAVATAQLQQQQQQLTAAALQRP 598

  Fly   660 GAPVMPHNGTQVRPASSVSTQTAQNQSLLKAKMRNKQQPVRPALATLKTEIGQVAGQNKVVGHLT 724
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   599 GAPVMPHNGTQVRPASSVSTQTAQNQSLLKAKMRNKQQPVRPALATLKTEIGQVAGQNKVVGHLT 663

  Fly   725 TVQQQQQATNLQQVVNAAGNKMVVMSTTGTPITLQNGQTLHAATAAGVDKQQQQLQLFQKQQILQ 789
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.|| 
  Fly   664 TVQQQQQATNLQQVVNAAGNKMVVMSTTGTPITLQNGQTLHAATAAGVDKQQQQLQLFQKQHIL- 727

  Fly   790 QQQMLQQQIAAIQMQQQQAAVQAQQQQQQQVSQQQQVNAQQQQAVAQQQQAVAQAQQQQREQQQQ 854
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   728 QQQMLQQQIAAIQMQQQQAAVQAQQQQQQQVSQQQQVNAQQQQAVAQQQQAVAQAQQQQREQQQQ 792

  Fly   855 VAQAQAQHQQALANATQQILQVAPNQFITSHQQQQQQQLHNQLIQQQLQQQAQAQVQAQVQAQAQ 919
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   793 VAQAQAQHQQALANATQQILQVAPNQFITSHQQQQQQQLHNQLIQQQLQQQAQAQVQAQVQAQAQ 857

  Fly   920 QQQQQREQQQNIIQQIVVQQS-GATSQQTSQQQQHHQSGQLQLSSVPFSVSSSTTPAGIA--TSS 981
            ||||||||||||||||||||| |||||| .|||...|||||||||||||||.|.|...||  |||
  Fly   858 QQQQQREQQQNIIQQIVVQQSTGATSQQ-QQQQPQQQSGQLQLSSVPFSVSPSMTAEDIAGITSS 921

  Fly   982 ALQAALSASGAIFQTAKPGTCSSSS-PTSSVVTITNQSSTPLVTSSTVASIQQAQTQSAQVHQHQ 1045
            |||.|||.|||||||.||.|||||: |||||||||:||||||||||||||:||||||..|:||||
  Fly   922 ALQEALSVSGAIFQTTKPITCSSSTLPTSSVVTITSQSSTPLVTSSTVASMQQAQTQGTQIHQHQ 986

  Fly  1046 QLISATIAGGTQQQPQ----GPPSLT-----PTTNPILAMTSMMNATVGHLSTAPPVTVSVTSTA 1101
            ||||||||||:|||.|    |.||||     |||||||||||||||||||||||||  |||:|||
  Fly   987 QLISATIAGGSQQQQQQQQLGLPSLTPTTPSPTTNPILAMTSMMNATVGHLSTAPP--VSVSSTA 1049

  Fly  1102 VTSSPGQLVLLSTASSGGGGSIPATPTKETPSKGPTATLVPIGSPKTPVSGKDTCTTPKSSTPAT 1166
            ||.|.||||.||:||||||...||||||||||||||||||||.||||||||||||||||||||||
  Fly  1050 VTPSSGQLVTLSSASSGGGAGFPATPTKETPSKGPTATLVPIDSPKTPVSGKDTCTTPKSSTPAT 1114

  Fly  1167 VSASVEASSSTGEALSNGDASDRSSTPSKGATTPTSKQSNAAVQPPSSTTPNSVSGKEEPKLATC 1231
            |||||||||||||||||||||||||||||||||||||||||||||||||.||||||||||||.||
  Fly  1115 VSASVEASSSTGEALSNGDASDRSSTPSKGATTPTSKQSNAAVQPPSSTIPNSVSGKEEPKLTTC 1179

  Fly  1232 GSLTSATSTSTTTTITNGIGVARTTASTAVSTASTTTTSSGTFITSCTSTTTTTTSSISNGSKDL 1296
            |||||||||||||||||||||||||||||||||||||||||||.|||||||||||||||||||||
  Fly  1180 GSLTSATSTSTTTTITNGIGVARTTASTAVSTASTTTTSSGTFTTSCTSTTTTTTSSISNGSKDL 1244

  Fly  1297 PKAMIKPNVLTHVIDGFIIQEANEPFPVTRQRYADKDVSDEPPKKKATMQEDIKLSGIASAPGSD 1361
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly  1245 PKAMIKPNVLTHVIDGFIIQEANEPFPVTRQRYADKDVSDEPPKKKATMQEDIKLSGIASAPGSD 1309

  Fly  1362 MVACEQCGKMEHKAKLKRKRYCSPGCSRQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRLDEA 1426
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly  1310 MVACEQCGKMEHKAKLKRKRYCSPGCSRQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRLDEA 1374

  Fly  1427 MAEEKMQTEATPKLSESFPILGASTEVPPMSLPVQAAISAPSPLAMPLGSPLSVALPTLAPLSVV 1491
            |||||||||:...:|::.||..|:.||||:|:||.||:|..|||::||..||.:|:.....|.||
  Fly  1375 MAEEKMQTESYQTVSDALPIQAATPEVPPISMPVLAAMSTSSPLSLPLTLPLPIAIAPTVSLPVV 1439

  Fly  1492 TSG-AAP----KSSEVNGTDRPPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEK 1551
            ::| .||    .||.:||:||||||||||::|||||||||||||||||||||||||||||||||.
  Fly  1440 SAGVVAPVLAIPSSNINGSDRPPISSWSVEEVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEN 1504

  Fly  1552 HLVNAMGMKLGPALKIVAKVESIKEVPPPGEAKD 1585
            |||||||||||||||||||||||||| |||:.||
  Fly  1505 HLVNAMGMKLGPALKIVAKVESIKEV-PPGDVKD 1537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 65/68 (96%)
SAM 1511..1576 CDD:197735 62/65 (95%)
ph-dNP_524794.2 SAM_Ph1,2,3 1461..1529 CDD:188976 65/68 (96%)
SAM 1464..1529 CDD:197735 62/65 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C357606421
eggNOG 1 0.900 E1_28JS2
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 190 1.000 Inparanoid score I3804
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0013815
orthoMCL 1 0.900 OOG5_138690
Panther 1 1.100 P PTHR12247
RoundUp 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.