DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ph-p and phc1

Sequence 1:NP_476871.2 Gene:ph-p FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:XP_005158395.1 Gene:phc1 ZFINID:ZDB-GENE-081022-39 Length:901 Species:Danio rerio

Alignment Length:1100 Identity:268/1100 (24%)
Similarity:400/1100 (36%) Gaps:314/1100 (29%)


  Fly   570 NQPDGTQGMFIQQQPATQTLQTQQNQIIQCNVTQTPTKARTQLDALAPKQQQQQQQVGTTNQTQQ 634
            ::|.....|.:.::.|.|.||..|.|                     |...|..||:     ..|
Zfish    23 SRPPQIAQMSLYERQAVQALQALQRQ---------------------PNAAQYFQQL-----MLQ 61

  Fly   635 QQLAVATAQLQQ--QQQQLTAAALQRPGAPVMPHNGTQVRPASSVSTQTAQNQSLLKA--KMRNK 695
            ||:..||.||..  ..||.|.||.::..:|    |.:..:|.|  |.|...|.|...|  .|.| 
Zfish    62 QQINSATCQLHNLAAVQQATLAASRQSSSP----NNSASQPTS--SAQCTVNLSTTSAGGTMTN- 119

  Fly   696 QQPVRPALATLKTEIGQ--VAGQNKVVGHLTTVQQQQQATNLQQVVNAAGNKMVVMSTTGTPITL 758
            .:|:.||.:...|.:.|  :.|.|       :..|.|....:.:.:.|.....::....||    
Zfish   120 PRPIGPATSAASTALSQSVLLGGN-------SGGQGQMYLRVNRSLRAPLTPQLIFMPGGT---- 173

  Fly   759 QNGQTLHAATAAGVDKQQQQLQLFQKQQILQQQQMLQQQIAAIQMQQQQAAVQAQQQQQQQVSQQ 823
               .|...||.|....|||.          |||.         |.||||.|.......|   |..
Zfish   174 ---ATATVATVAQTQPQQQP----------QQQP---------QQQQQQEATPTSSSSQ---SDN 213

  Fly   824 QQVNAQQQQAVAQQQQAVAQAQQQQREQQQQVAQAQAQHQQALANATQQILQVAPNQFITSHQQQ 888
            .||.....:.|:..:.|..:.:...|::.........|.|             .|.||..|.|| 
Zfish   214 DQVQNLAMRCVSTPRAATVKTEFADRKETTGTFPLNQQTQ-------------TPQQFGQSTQQ- 264

  Fly   889 QQQQLHNQLIQQQLQQQAQAQVQA-------QVQAQAQQQQQQREQQQNIIQQIVVQQSGATSQQ 946
                     :|.|.|..|.|::|:       .|.|...:...|        ..:..||:||:|..
Zfish   265 ---------VQPQTQPLANAKLQSFSNTANPSVPALNVKPTNQ--------SAVAPQQAGASSNP 312

  Fly   947 TSQQQQHHQSGQLQLSSVPFSVSSSTTPAGIATSSALQAALSASGAIFQTAKPGTCSSSS----P 1007
            .                     |||.||: :..|   |..||.||.......||:.::.:    |
Zfish   313 P---------------------SSSPTPS-LPLS---QLLLSQSGLHQTRGVPGSTATVTHILVP 352

  Fly  1008 TSSVVTITNQSSTPLVTSSTVASIQQAQTQSAQVHQH--QQLISATIAGGT-------------- 1056
            ||:|.|.|  ...||.|.:|.::: .|||...|..|.  ..|.:..:|.||              
Zfish   353 TSNVPTST--QGYPLGTVATKSNM-TAQTLVVQPLQQTGANLSTEKLAHGTGHVPIQPKTAQGHR 414

  Fly  1057 ---QQQPQGPPSLTPT----------TNPILAMTSMMNATVGHLSTAPPVTVSVTSTAVT----- 1103
               |..|:.||.:.|.          .:|......::.|....|..:..:.::...|..:     
Zfish   415 VPVQMSPRHPPPILPAPPNNGQATAGLHPPHVPVQLVGARQSTLGNSQALALAQARTCCSQQDGT 479

  Fly  1104 -----SSPGQLVLLSTA--SSGGGGSIPATPTKETPSKGPTATLVPIGSPKTPVSGKDTCTTPKS 1161
                 ::||.:|.:.||  :||.|..:..           ..:.:||...:|..|     .....
Zfish   480 AAVGVNNPGNVVTMVTAMDTSGAGMCLKT-----------AQSALPISQMQTNQS-----AVLSQ 528

  Fly  1162 STPATVSASVEASSSTGEALSNGDASDRSSTPSKGATTPTSKQSNAAVQPPSSTTPNSVSGKEEP 1226
            ..||:|:.|::..:::|::|....|    ....|.|..|..::|.:.:....|..|  :||  .|
Zfish   529 GNPASVTHSMDGQNNSGDSLFVQSA----QAQIKPAIGPIKRKSESDLTHEISNEP--ISG--SP 585

  Fly  1227 KLA-TCGSLTSATSTSTTTTITNGIGVARTTASTAVSTASTTTTSSGTFITSCTSTTTTTTSSIS 1290
            .:. :...|:.|.|..|...|             |.|:..|.:          .|..........
Zfish   586 SMQDSAPPLSPAPSLDTVPEI-------------AFSSPPTLS----------LSLPLPLPRGAG 627

  Fly  1291 NGSK-DLPKAMIKPNVLTHVIDGFIIQEANEPFPVTRQRYADKDVSDEPPKKKATMQEDIKLSGI 1354
            .|.: .:|:|::||.||||:|:||:|||..||||||...   |::|...|  .....|||:    
Zfish   628 QGDRAPVPQAVVKPQVLTHLIEGFVIQEGAEPFPVTGPL---KELSGAVP--PILHPEDIR---- 683

  Fly  1355 ASAPGSDMVACEQCGKMEHKAKLKR-KRYCSPGCSR----------QAKNGIGGVGSGETNGLGT 1408
                 ||.:.||.|......::.:| ||:|:..||:          :|..|:.|...      ..
Zfish   684 -----SDKLKCEYCLNFAPASQFRRSKRFCTISCSKRYNVSFRNHLRASRGLEGAER------PA 737

  Fly  1409 GGIVGVDAMALVDRLDEAMAEEKMQTEATPKLSESFPILGASTEVPPMSLPVQA----------- 1462
            ||.|..|.:|               ....|:.|.|..   |..::....|||:.           
Zfish   738 GGPVVQDVIA---------------RRRAPRRSSSEI---ACAKITGRHLPVKCRSESSRSDDIS 784

  Fly  1463 -----------AISAPSPLAMPLGSPLSVALPTLAPLSVVTSGAAPKSSEVNGTDRPPISSWSVD 1516
                       ::|..|..:.|..:.....|...||      |..|.......:..|  :.|||.
Zfish   785 SCEGEEEEDFLSLSPSSTFSCPRPTHCGPQLDDTAP------GGLPVDENHFLSGNP--ADWSVQ 841

  Fly  1517 DVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHLVNAMGMKLGPALKIVAKVESIKE 1576
            :|..||..|.||:|....|:.||||||||:||||:||::.|.:||||||||.|.:.|:::
Zfish   842 EVCQFISSLQGCEDLASQFLSQEIDGQALMLLKEEHLMSTMNIKLGPALKICASINSLRD 901

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 37/68 (54%)
SAM 1511..1576 CDD:197735 36/65 (55%)
phc1XP_005158395.1 PHC2_SAM_assoc <763..832 CDD:293222 11/75 (15%)
SAM_Ph1,2,3 834..901 CDD:188976 37/69 (54%)
SAM 835..901 CDD:197735 37/68 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JS2
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128665
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4720
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.