DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ph-p and Sfmbt

Sequence 1:NP_476871.2 Gene:ph-p FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:NP_001137821.1 Gene:Sfmbt FlyBaseID:FBgn0032475 Length:1243 Species:Drosophila melanogaster

Alignment Length:291 Identity:70/292 (24%)
Similarity:103/292 (35%) Gaps:96/292 (33%)


  Fly  1359 GSDMVACEQCGKMEHKAKLKRKRYCSPGCSRQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRL 1423
            |...||.:|..|...|.|::||        |:.|.|..|   |:|.               .|..
  Fly   974 GPPRVAHQQAPKPAPKPKIQRK--------RKPKKGAAG---GKTP---------------TDNN 1012

  Fly  1424 DEAMAEEKMQTEATPKLSESFPILGASTEVPP--------------------------------M 1456
            .:::....:..:.||.|    |.|....|:.|                                .
  Fly  1013 TQSVKSRTIALKTTPHL----PKLSIKLELKPEHHNAAFYENNQPEEEGDEEDPDADGDGDGSTS 1073

  Fly  1457 SLPVQAAISAPSPLAMPLGSPL-SVALPTLA-------PLSVVTSGAAP-----------KSSEV 1502
            .:..|:...:.|.|....||.. |.:|.|||       ..|...|.|.|           .||..
  Fly  1074 HISEQSTTQSSSDLIAGSGSGSGSASLVTLATGSNKTVKKSTTKSPAPPTVGRKATSYIANSSAT 1138

  Fly  1503 NGTDRPPIS--------------SWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHL 1553
            |....|.::              :|:|.|||.|:| :..|..:.|.|.:.:|||:.||.|.:..:
  Fly  1139 NNKYIPRLADIDSSEPHLELVPDTWNVYDVSQFLR-VNDCTAHCDTFSRNKIDGKRLLQLTKDDI 1202

  Fly  1554 VNAMGMKLGPALKIVAKVESIKEVPPPGEAK 1584
            :..:|||:||||||...:..:|....||.|:
  Fly  1203 MPLLGMKVGPALKISDLIAQLKCKVNPGRAR 1233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 27/82 (33%)
SAM 1511..1576 CDD:197735 26/79 (33%)
SfmbtNP_001137821.1 MBT 542..647 CDD:214723
MBT 658..753 CDD:214723
MBT 767..871 CDD:214723
MBT 882..975 CDD:214723 1/1 (100%)
TonB_N <975..1040 CDD:292650 21/95 (22%)
SAM_Scm-like-4MBT 1160..1226 CDD:188979 26/67 (39%)
SAM 1160..1224 CDD:197735 25/65 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86047749
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12247
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.