DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ph-p and Sfmbt

DIOPT Version :9

Sequence 1:NP_476871.2 Gene:ph-p / 31181 FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:NP_001137821.1 Gene:Sfmbt / 34709 FlyBaseID:FBgn0032475 Length:1243 Species:Drosophila melanogaster


Alignment Length:291 Identity:70/291 - (24%)
Similarity:103/291 - (35%) Gaps:96/291 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1359 GSDMVACEQCGKMEHKAKLKRKRYCSPGCSRQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRL 1423
            |...||.:|..|...|.|::||        |:.|.|..|   |:|.               .|..
  Fly   974 GPPRVAHQQAPKPAPKPKIQRK--------RKPKKGAAG---GKTP---------------TDNN 1012

  Fly  1424 DEAMAEEKMQTEATPKLSESFPILGASTEVPP--------------------------------M 1456
            .:::....:..:.||.|    |.|....|:.|                                .
  Fly  1013 TQSVKSRTIALKTTPHL----PKLSIKLELKPEHHNAAFYENNQPEEEGDEEDPDADGDGDGSTS 1073

  Fly  1457 SLPVQAAISAPSPLAMPLGSPL-SVALPTLA-------PLSVVTSGAAP-----------KSSEV 1502
            .:..|:...:.|.|....||.. |.:|.|||       ..|...|.|.|           .||..
  Fly  1074 HISEQSTTQSSSDLIAGSGSGSGSASLVTLATGSNKTVKKSTTKSPAPPTVGRKATSYIANSSAT 1138

  Fly  1503 NGTDRPPIS--------------SWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHL 1553
            |....|.::              :|:|.|||.|:| :..|..:.|.|.:.:|||:.||.|.:..:
  Fly  1139 NNKYIPRLADIDSSEPHLELVPDTWNVYDVSQFLR-VNDCTAHCDTFSRNKIDGKRLLQLTKDDI 1202

  Fly  1554 VNAMGMKLGPALKIVAKVESIKEVPPPGEAK 1584
            :..:|||:||||||...:..:|....||.|:
  Fly  1203 MPLLGMKVGPALKISDLIAQLKCKVNPGRAR 1233

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 26/81 (32%)
SAM 1511..1576 CDD:197735 25/78 (32%)
SfmbtNP_001137821.1 MBT 542..647 CDD:214723
MBT 658..753 CDD:214723
MBT 767..871 CDD:214723