DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ph-p and SAMD7

Sequence 1:NP_476871.2 Gene:ph-p FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:NP_001291295.1 Gene:SAMD7 HGNCID:25394 Length:446 Species:Homo sapiens

Alignment Length:495 Identity:104/496 (21%)
Similarity:155/496 (31%) Gaps:162/496 (33%)


  Fly  1119 GGGSIPATPTKETPSKGPTATLVPIGSPKTPVSGKDTCTTPKSSTPATVSASVEASSSTGEALSN 1183
            |..:||..|   :|...||.....:.|...|...:..|      .|:...:||..:::....||:
Human    11 GQQTIPLIP---SPFGPPTVDRDVLPSTVAPTDPRQFC------VPSQFGSSVLPNTNMANVLSS 66

  Fly  1184 --------------GDASDRSSTPSKGATTPTSKQSNAAVQP--PSSTTPNSVSGKEEPKLATCG 1232
                          ...:.|:....:..|..|..:..|..|.  .....|..::|...|.|  .|
Human    67 RIYPGWGILPPESIKAVARRNEMIQRHHTARTEMEMYAIYQQRRMEKINPKGLAGLGIPFL--YG 129

  Fly  1233 SLTSATSTSTTTTITNGIGVARTTASTAVSTASTTTTSSGTFITSCTS--------------TTT 1283
            |...|...:..       |.:...|.......||.....|..:.:.|:              ...
Human   130 SSVPAAPAAYH-------GRSMLPAGDLHFHRSTLRNLQGNPMLAATAPHFEESWGQRCRRLRKN 187

  Fly  1284 TTTSSISNGSKDLPKAMIKPNVL--THVIDGFIIQEANEPFPVTRQRYA-DKDVSDEPPKKKATM 1345
            |......:...:..|:..:..:|  ||.:            |.....|| |.|: :.|..:|::.
Human   188 TGNQKALDSDAESSKSQAEEKILGQTHAV------------PYEEDHYAKDPDI-EAPSNQKSSE 239

  Fly  1346 QEDIKLSGIASAPGSDMVACEQCGKME---------HKAKLKRKRYCSPGCSRQAKNGIGGVGSG 1401
            ..:...:.:|:.          ||::|         |...||.|.:                   
Human   240 TNEKPTTALANT----------CGELEPTHRKPWGSHTTTLKAKAW------------------- 275

  Fly  1402 ETNGLGTGGIVGVDAMALVDRLDEAMAEEKMQTEATPKLSESFPILGASTEVPPMSLPVQAAISA 1466
                                  |:...|...|..||.....     |....||..|||...|:  
Human   276 ----------------------DDGKEEASEQIFATCDEKN-----GVCPPVPRPSLPGTHAL-- 311

  Fly  1467 PSPLAMPLGSPLSVALPTLAPLSVVTSGAAPKSSEVNGTDRPPISSWSVDDVSNFIRELPGCQDY 1531
                 :.:|..||:                          ...|..|:||||.:|||.||||.||
Human   312 -----VTIGGNLSL--------------------------DEDIQKWTVDDVHSFIRSLPGCSDY 345

  Fly  1532 VDDFIQQEIDGQALLLLKEKHLVNAMGMKLGPALKIVAKV 1571
            ...|....|||:.|.||.|:||...||:||||||||.::|
Human   346 AQVFKDHAIDGETLPLLTEEHLRGTMGLKLGPALKIQSQV 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 36/65 (55%)
SAM 1511..1576 CDD:197735 35/62 (56%)
SAMD7NP_001291295.1 SAM_Samd7,11 324..391 CDD:188978 36/63 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.