DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ph-p and Phc2

Sequence 1:NP_476871.2 Gene:ph-p FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:NP_001013187.2 Gene:Phc2 RGDID:1307912 Length:850 Species:Rattus norvegicus

Alignment Length:953 Identity:252/954 (26%)
Similarity:378/954 (40%) Gaps:224/954 (23%)


  Fly   738 VVNAAGNKMVVMSTTGTPITLQNGQTLHAATAAGVDKQ--QQQLQLF------QKQQILQQQQML 794
            |.:.:....:..:|:||     |..:..::::.|...:  ..|:.::      |..|::||....
  Rat     7 VPHTSSRASITTNTSGT-----NSSSGCSSSSGGGSGRPTAPQISVYSGIPDRQTVQVIQQALHR 66

  Fly   795 QQQIAAIQMQQQQAAVQAQQQQQQQVSQQQQVNAQQQQAVAQQQQAVAQAQQQQREQQQQV-AQA 858
            |...||..:||..||.|.....|....|||.:::.|.|::|..|||...|.:|.......| :||
  Rat    67 QPSTAAQYLQQMYAAQQQHLMLQTAALQQQHLSSAQLQSLAAVQQASLVANRQGSTSGSSVSSQA 131

  Fly   859 QAQHQQ---ALANATQQILQVAP--NQFITSHQQQQQQQLHN----QLIQQQLQQQAQAQ----- 909
            .||...   |.:.|..|::..|.  |....|...||...|.|    .|...|.|...:||     
  Rat   132 PAQSSSLNLAASPAAAQLINRAQSVNSATASGLAQQAVLLGNTSSPALTASQAQMYLRAQMLIFT 196

  Fly   910 -------VQAQVQAQAQQQQQQREQQQNIIQQIVVQQSGATSQQTSQQQQHHQSGQLQLSSVPFS 967
                   ||.::...:..:.....|.||:               |.:.||...:.....:|.|  
  Rat   197 PTATVATVQPELGTGSPARPPTPAQVQNL---------------TLRTQQTPAAAAAAAASGP-- 244

  Fly   968 VSSSTTPAGIATSSALQAALSASGAIFQTAKPGTCSSSSPTSSVVTITNQSSTPLVTSS------ 1026
              :.|.|  :..|.||:...|:|..:..|.:..|....||..:..::|:..:.||.|..      
  Rat   245 --APTQP--VLPSLALKPTPSSSQPLPPTPQGRTVVQGSPVGAKPSVTDNVTEPLKTDGNSNMEA 305

  Fly  1027 ----------TVASIQQAQTQSAQVHQHQQLISAT--------IAGGTQQQPQGPPSLTP--TTN 1071
                      |||:.|.......|:..||.|...:        :|   ||||| ||..||  .:.
  Rat   306 RPGPDRATVPTVATHQLTAPAYTQLQPHQLLPQPSSKHPQPQFVA---QQQPQ-PPRPTPQVQSQ 366

  Fly  1072 PILAMTS----MMNATVGHLSTAPPVTVSV---TSTAVTSSPG--QLVLLSTASSGGGGSIPATP 1127
            |.||..|    :..:..||.....|||.::   .|||....||  |...|.|..||.....|   
  Rat   367 PQLAAVSPSLALQPSPEGHAMPLGPVTQALPLQCSTAHVHKPGSSQQCHLPTPDSGSQNGHP--- 428

  Fly  1128 TKETPSKGP------TATLVPIGSPKTPVSGKDTCTTPKSSTPATVSASVEASSSTGEALSNGDA 1186
              |..|..|      |:.::....|.:||        |:...|......|.|..|.         
  Rat   429 --EGVSHAPQRRFQHTSAVILQLQPASPV--------PQQCAPDDWKEVVPAEKSV--------- 474

  Fly  1187 SDRSSTPSKGATTPTSKQSNAAVQPPSSTTPNSVSGKEEPKLATCGSLTSATSTSTTTTITNGIG 1251
                     ..|.|.......|:   .:..|..:.|.:.|.:..|    .|..|        |.|
  Rat   475 ---------PVTRPGLSPHQQAI---ITAIPGGLPGPKSPNIQQC----PAHET--------GQG 515

  Fly  1252 VARTTASTAVSTASTTTTSSGTFITSCTSTTTTTTSSISNGSKDLPKAMIKPNVLTHVIDGFIIQ 1316
            :..         |.|..:|.|....:..|.::.|.::..||....|:|::||.:|||||:||:||
  Rat   516 IVH---------ALTDLSSPGMTSGNGNSASSITGTAPQNGENKPPQAIVKPQILTHVIEGFVIQ 571

  Fly  1317 EANEPFPVTR---------QRYADKDVSDEPPKKKATMQEDIKLS----GIASAPGSDM-VACEQ 1367
            |..|||||.|         ::||...:.::.|::..|...|.::.    ..:...|:.: :.||.
  Rat   572 EGAEPFPVGRSSLLVGNLKKKYAQGFLPEKLPQQDHTTTTDSEMEEPYLQESKEEGTPLKLKCEL 636

  Fly  1368 CGKMEHKAKLKR-KRYCSPGCSRQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRLDEAMAEEK 1431
            ||:::...|.|| ||:||..|:::.     .||..:..||...           ||       .|
  Rat   637 CGRVDFAYKFKRSKRFCSMACAKRY-----NVGCTKRVGLFHS-----------DR-------SK 678

  Fly  1432 MQTEATPKLSE------SFPILGASTEVPP---MSLPVQAAIS-APSPLAMPLGSPLSVALPTLA 1486
            :|...|...:.      |.|.|...|:..|   :.|.|.||:. |.|.......|..|.....|:
  Rat   679 LQKAGTTTHNRRRASKASLPTLTKDTKKQPSGTVPLSVTAALQLAHSQEDSSRCSDNSSYEEPLS 743

  Fly  1487 PLSVVTSGAAPKS-------SEVNGTD-----------RPPISSWSVDDVSNFIRELPGCQDYVD 1533
            |:|..:|.:..:.       |:::..|           .|  :.|:|:||..|||.|||||:..:
  Rat   744 PISASSSTSRRRQGQRDLELSDMHMRDLVGMGHHFLPSEP--TKWNVEDVYEFIRSLPGCQEIAE 806

  Fly  1534 DFIQQEIDGQALLLLKEKHLVNAMGMKLGPALKIVAKVESIKE 1576
            :|..|||||||||||||.||::||.:||||||||.|::..:|:
  Rat   807 EFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKD 849

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 41/68 (60%)
SAM 1511..1576 CDD:197735 40/65 (62%)
Phc2NP_001013187.2 PHC2_SAM_assoc 662..780 CDD:293222 28/136 (21%)
SAM_Ph1,2,3 781..849 CDD:188976 41/70 (59%)
SAM 783..850 CDD:197735 41/70 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JS2
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T131172
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.