DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ph-p and Samd11

Sequence 1:NP_476871.2 Gene:ph-p FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:XP_006538909.1 Gene:Samd11 MGIID:2446220 Length:558 Species:Mus musculus

Alignment Length:554 Identity:130/555 (23%)
Similarity:188/555 (34%) Gaps:177/555 (32%)


  Fly  1129 KETPSKGPTAT-LVPIGSPKTPVSGKDTCTTPKSSTPATVSASVEASS--STGEALSNGDASDRS 1190
            |:..||.|.|| |:|         ..::...|:......:||..||||  .|......|      
Mouse    43 KKARSKDPQATSLLP---------ELESTMAPEDHYHQLMSALSEASSFEETQRLYHLG------ 92

  Fly  1191 STPSKGATTPTSKQSNAAVQPPSSTTPNSVSGKEEPKLAT----CGSLTSATSTSTTTTITNGIG 1251
             .||.| ..||  .....:.||.|   :.:..::|...||    .|......|::.......|:.
Mouse    93 -IPSHG-IEPT--YQGGPLSPPFS---DLLRVRQEVATATLRGPSGLEVHLPSSTADHRRKQGLV 150

  Fly  1252 VARTTASTAVSTASTTTTSSGTFITSCTSTTTTTTSSISNGSKDLPKAMIKPNVLTHVIDGFIIQ 1316
            ..|..|..|.:|                        |.|......|..::.|....|:.   :..
Mouse   151 QRREGAVPAAAT------------------------SFSEREMSQPPPLLSPQNAAHIT---MSS 188

  Fly  1317 EANEPF---PVTRQRYADKDVSDEP-----PKKKATM----QEDIKLSGIASAPGSDMVACEQCG 1369
            ....||   |..        |...|     |..:|.|    ||.::...:|....|:::..::.|
Mouse   189 HLRPPFLGMPTA--------VCQTPGFSFLPSAQAEMLARQQELLRKQSLARLEMSELLRQKELG 245

  Fly  1370 KM---------------EHKAKLKRK------RYCS-------------PG---------CSRQA 1391
            .:               |...:|:|:      ::.|             ||         .||..
Mouse   246 SVHRPLLPAPEVALHIPEGPDELQRRGSMLVLKHSSAPLLALPPQGPPGPGPPIPPKESARSRSE 310

  Fly  1392 KNGIGGVGS--GETNGLGTGGIVGVDAMALVDRLDEAMAEEKMQTEA------TPK-------LS 1441
            |..:|...|  .||.|      .|:.|..:.:...:....|..:|.|      ||.       .:
Mouse   311 KGSLGVQPSQPKETTG------AGLWAQEVSEEPSKDSDGEDPETAAAREGTSTPSQVPAGGTRA 369

  Fly  1442 ESFPILGASTEVPPMSLPVQAAISAPSPLAMPLGSPLSVALPTLAPLSVVTSGAAPKSSEVNGTD 1506
            |...:|..||..||                :|||.|.....|.   ....|.|......|.  |.
Mouse   370 EGRGLLSGSTLPPP----------------LPLGFPCGAVSPY---FHTGTMGGLFTDEET--TT 413

  Fly  1507 RPPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHLVNAMGMKLGPALKIVAKV 1571
            ...::.|:||||.||:..|.||.:|...|.:|.|||:.|.||.|:||:|.||:||||||||.|:|
Mouse   414 LEDVNKWTVDDVCNFVGGLSGCGEYARVFGEQGIDGETLPLLTEEHLLNTMGLKLGPALKIRAQV 478

  Fly  1572 E--------------SIKEVPPPGEAKD--PGAQ 1589
            .              ::...||..:|.:  ||.|
Mouse   479 AKRLGRVFYMASFPVALPLQPPSLQAPELSPGHQ 512

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 35/82 (43%)
SAM 1511..1576 CDD:197735 35/79 (44%)
Samd11XP_006538909.1 SAM_Samd7,11 417..484 CDD:188978 35/67 (52%)
SAM 417..474 CDD:197735 32/57 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.