DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ph-p and PHC1

Sequence 1:NP_476871.2 Gene:ph-p FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:XP_011518905.1 Gene:PHC1 HGNCID:3182 Length:1021 Species:Homo sapiens

Alignment Length:1309 Identity:308/1310 (24%)
Similarity:457/1310 (35%) Gaps:383/1310 (29%)


  Fly   362 MLTTTTQNAKQMIGGQAGFAGGNYATCIPTNHNQSPQTVLFSPMNVISPQQQQNLLQSMAAAAQQ 426
            |.|.:.||:....|..:  :||       ::..|..|..|:          ::..:|::.|..:|
Human     1 METESEQNSNSTNGSSS--SGG-------SSRPQIAQMSLY----------ERQAVQALQALQRQ 46

  Fly   427 QQLTQQQQQFNQQQQQQLTQQQQQLTAALAKV------GVDAQGKLAQKVV-------------- 471
            ....|...||  ..||||:..|....||:.:|      |...:|:..|..:              
Human    47 PNAAQYFHQF--MLQQQLSNAQLHSLAAVQQVRGQQPAGPRGRGQALQATIAASRQASSPNTSTT 109

  Fly   472 -QKVTTTSSAVQAATGPGSTGSTQTQQVQQVQQQQQQTTQTTQQCVQVSQSTLPVGVGGQSVQTA 535
             |:.|||.:::..||      ::..|.:.:.|.....:..|..|.|.:..:|.|.          
Human   110 QQQTTTTQASINLAT------TSAAQLISRSQSVSSPSATTLTQSVLLGNTTSPP---------- 158

  Fly   536 QLLNAGQAQQMQIPWFLQNAAG--LQ---PFGPN-----QIILRNQPDGTQGMFIQQQPATQT-- 588
              ||..|||.     :|:...|  ||   ..|.|     |:||  .|:|......|:.|:.|:  
Human   159 --LNQSQAQM-----YLRPQLGNLLQVNRTLGRNVPLASQLIL--MPNGAVAAVQQEVPSAQSPG 214

  Fly   589 LQTQQNQIIQCNVTQTPTKARTQLDALAPKQQQQQQQ--------VGTTNQTQQQQLAVATAQLQ 645
            :....:|:      |.......|..|..|:.|...|:        |.:.:|...|.||||.|...
Human   215 VHADADQV------QNLAVRNQQASAQGPQMQGSTQKAIPPGASPVSSLSQASSQALAVAQASSG 273

  Fly   646 QQQQQLTAA-----------ALQRPGAPVMPHNGTQVRPASSVSTQTAQNQSLLKAKMRNKQQPV 699
            ...|.|..:           ....||.....|.|....|:|.:...:...      |.....||:
Human   274 ATNQSLNLSQAGGGSGNSIPGSMGPGGGGQAHGGLGQLPSSGMGGGSCPR------KGTGVVQPL 332

  Fly   700 RPALATLKTEIGQVAGQNKVVGHLTTVQ---QQQQATNLQQVVNAAGNKMVVMSTTGTPITLQNG 761
             ||..|:....|................   ||....||.:....|.::.::.|.|.|.|...: 
Human   333 -PAAQTVTVSQGSQTEAESAAAKKAEADGSGQQNVGMNLTRTATPAPSQTLISSATYTQIQPHS- 395

  Fly   762 QTLHAATAAGVDKQQQQLQLFQKQQILQQQQMLQQQIAAIQMQQQQAAVQAQQQQQQQVSQQQQV 826
                      :.:||||:.|.|||.::|||                  :....|||.|..|.|.:
Human   396 ----------LIQQQQQIHLQQKQVVIQQQ------------------IAIHHQQQFQHRQSQLL 432

  Fly   827 NAQQQQAVAQQQQAVAQAQQQQREQQQQVAQAQAQHQQALANATQQILQVAPNQFITSHQQQQQQ 891
            :......:||||      ||||::||||      |..||......|..||.|.|.:...|.|||.
Human   433 HTATHLQLAQQQ------QQQQQQQQQQ------QQPQATTLTAPQPPQVPPTQQVPPSQSQQQA 485

  Fly   892 QLHNQLIQQQLQQQAQAQVQAQVQAQAQQQQQQREQQQNIIQQIVVQQSGATSQQTSQQQQHHQS 956
            |  ..::|..||..     ...:...|..:.....|.:..:..|...|.||.....:||...|  
Human   486 Q--TLVVQPMLQSS-----PLSLPPDAAPKPPIPIQSKPPVAPIKPPQLGAAKMSAAQQPPPH-- 541

  Fly   957 GQLQLSSVPFSVSSSTTPAGIATSSALQAALSASGAIFQTAKPGTCSSSSPTSSVVTITNQSSTP 1021
                   :|..|..:..| |.|.:.||..|..|:........|||                    
Human   542 -------IPVQVVGTRQP-GTAQAQALGLAQLAAAVPTSRGMPGT-------------------- 578

  Fly  1022 LVTSSTVASIQQAQTQSAQVHQHQQLISATIAGGTQQQPQGPPSLTP--TTNPILAMTSMMNATV 1084
                          .||.|.|......|:...|..|   :.||:|.|  |..|:.....::.   
Human   579 --------------VQSGQAHLASSPPSSQAPGALQ---ECPPTLAPGMTLAPVQGTAHVVK--- 623

  Fly  1085 GHLSTAPPVTVSVTSTAVTSS---PGQLVLLSTASSGGGGSIPATPTKETPSKGPTATLVPIGSP 1146
            |..:|:.||...|.:.....|   ||:...|:....       |...:|                
Human   624 GGATTSSPVVAQVPAAFYMQSVHLPGKPQTLAVKRK-------ADSEEE---------------- 665

  Fly  1147 KTPVSGKDTCTTPKSSTPATVSASVEASSSTGEALSNGDASDRSSTPSKGATTPTSKQSNAAVQP 1211
                  :|..:|..|..||..|...|:.....|..|.|:.::  |..:..|.||:|:.  .|:.|
Human   666 ------RDDVSTLGSMLPAKASPVAESPKVMDEKSSLGEKAE--SVANVNANTPSSEL--VALTP 720

  Fly  1212 PSSTTPNSVSGKEEPKLATCGSLTSATSTSTTTTITNGIGVARTTASTAVSTASTTTTSSGTFIT 1276
            ..|..|        |.||.                     |:|                      
Human   721 APSVPP--------PTLAM---------------------VSR---------------------- 734

  Fly  1277 SCTSTTTTTTSSISNGSKDLPKAMIKPNVLTHVIDGFIIQEANEPFPV---TRQRYADKDVSDEP 1338
                         ..|....|:|::||.:|||:|:||:|||..|||||   ...:.::|.:....
Human   735 -------------QMGDSKPPQAIVKPQILTHIIEGFVIQEGAEPFPVGCSQLLKESEKPLQTGL 786

  Fly  1339 PKKKATMQEDIKLSGIASAPG-----SDMVACEQCGKMEHKAKLK-RKRYCSPGCS--------- 1388
            |......|....| |:.|...     ::::.||.|||.....:.: .||:||..|:         
Human   787 PTGLTENQSGGPL-GVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSH 850

  Fly  1389 -----RQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRLDEAMAEEKMQTEATPKLSESFPILG 1448
                 |:................|.            .|....:|..|:|.:......:|     
Human   851 QFRLKRKKMKEFQEANYARVRRRGP------------RRSSSDIARAKIQGKCHRGQEDS----- 898

  Fly  1449 ASTEVPPMSLPVQAAISAPSPLAM-------PLGSPLSVALPTLAPLSVVTSGAAPKSSEVNGTD 1506
             |......|.....:.::|.||::       .||:|                ..||.:.|::|.:
Human   899 -SRGSDNSSYDEALSPTSPGPLSVRAGHGERDLGNP----------------NTAPPTPELHGIN 946

  Fly  1507 RPPISS----WSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHLVNAMGMKLGPALKI 1567
            ...:||    |||::|..||..|.|||:..::|..|||||||||||||:||::||.:||||||||
Human   947 PVFLSSNPSRWSVEEVYEFIASLQGCQEIAEEFRSQEIDGQALLLLKEEHLMSAMNIKLGPALKI 1011

  Fly  1568 VAKVESIKE 1576
            .||:..:||
Human  1012 CAKINVLKE 1020

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 41/72 (57%)
SAM 1511..1576 CDD:197735 41/69 (59%)
PHC1XP_011518905.1 zf-FCS 809..844 CDD:283998 10/35 (29%)
PHC2_SAM_assoc 845..951 CDD:293222 19/140 (14%)
SAM_Ph1,2,3 952..1020 CDD:188976 40/68 (59%)
SAM 954..1021 CDD:197735 40/68 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 203 1.000 Inparanoid score I3692
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130153
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4720
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.180

Return to query results.
Submit another query.