DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ph-p and SAMD11

DIOPT Version :9

Sequence 1:NP_476871.2 Gene:ph-p / 31181 FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:NP_001372569.1 Gene:SAMD11 / 148398 HGNCID:28706 Length:845 Species:Homo sapiens


Alignment Length:170 Identity:56/170 - (32%)
Similarity:80/170 - (47%) Gaps:42/170 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1436 ATPKLSESFPILGA-------STEVPPMSL----PVQAAISAPSPL------------------- 1470
            |:.:.|||..:.||       |.:.||...    |..||:....|.                   
Human   604 ASARPSESKEMTGARLWAQDGSEDEPPKDSDGEDPETAAVGCRGPTPGQAPAGGAGAEGKGLFPG 668

  Fly  1471 -AMPLGSPLSVALPTLAPLSVVTSGAAPKSSEVNGTDRP---PISSWSVDDVSNFIRELPGCQDY 1531
             .:|||.|.:|:       ....:||....| ::|.:.|   .::.|:||||.:|:..|.||.:|
Human   669 STLPLGFPYAVS-------PYFHTGAVGGLS-MDGEEAPAPEDVTKWTVDDVCSFVGGLSGCGEY 725

  Fly  1532 VDDFIQQEIDGQALLLLKEKHLVNAMGMKLGPALKIVAKV 1571
            ...|.:|.|||:.|.||.|:||:..||:||||||||.|:|
Human   726 TRVFREQGIDGETLPLLTEEHLLTNMGLKLGPALKIRAQV 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 34/67 (51%)
SAM 1511..1576 CDD:197735 33/61 (54%)
SAMD11NP_001372569.1 SAND 113..185 CDD:396076
SAM_Samd7,11 704..771 CDD:188978 33/62 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12247
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.