DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ph-p and SAMD11

Sequence 1:NP_476871.2 Gene:ph-p FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:NP_689699.2 Gene:SAMD11 HGNCID:28706 Length:681 Species:Homo sapiens

Alignment Length:170 Identity:56/171 (33%)
Similarity:80/171 (47%) Gaps:42/171 (25%)


  Fly  1436 ATPKLSESFPILGA-------STEVPPMSL----PVQAAISAPSPL------------------- 1470
            |:.:.|||..:.||       |.:.||...    |..||:....|.                   
Human   440 ASARPSESKEMTGARLWAQDGSEDEPPKDSDGEDPETAAVGCRGPTPGQAPAGGAGAEGKGLFPG 504

  Fly  1471 -AMPLGSPLSVALPTLAPLSVVTSGAAPKSSEVNGTDRP---PISSWSVDDVSNFIRELPGCQDY 1531
             .:|||.|.:|:       ....:||....| ::|.:.|   .::.|:||||.:|:..|.||.:|
Human   505 STLPLGFPYAVS-------PYFHTGAVGGLS-MDGEEAPAPEDVTKWTVDDVCSFVGGLSGCGEY 561

  Fly  1532 VDDFIQQEIDGQALLLLKEKHLVNAMGMKLGPALKIVAKV 1571
            ...|.:|.|||:.|.||.|:||:..||:||||||||.|:|
Human   562 TRVFREQGIDGETLPLLTEEHLLTNMGLKLGPALKIRAQV 601

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 34/68 (50%)
SAM 1511..1576 CDD:197735 33/62 (53%)
SAMD11NP_689699.2 SAM_Samd7,11 540..607 CDD:188978 33/63 (52%)
SAM 540..597 CDD:197735 30/57 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.