DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ph-p and Samd11

Sequence 1:NP_476871.2 Gene:ph-p FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:XP_008762634.1 Gene:Samd11 RGDID:1310271 Length:665 Species:Rattus norvegicus

Alignment Length:612 Identity:134/613 (22%)
Similarity:186/613 (30%) Gaps:236/613 (38%)


  Fly  1019 STPLVTS--------------STVASIQQAQTQSAQVHQHQQLISATIAGGTQQQPQ-----GPP 1064
            |.|.:||              .|:...:...|.:.:.|.| ||:||....|..::.|     |.|
  Rat   152 SCPYITSDCSSEKKARSKAPQETLLLPELESTMAPEDHYH-QLMSALSEAGPFEETQRLYHLGIP 215

  Fly  1065 S----------LTPT-TNPILAMTSMMNATVGHL----------STAPPVTVSVTSTAVTSSPGQ 1108
            |          .|.| ..|......:.::|.||.          .|.|..|.|.:...::..|  
  Rat   216 SHDLLRVRQEVATATLRGPSSLEVHLPSSTAGHRRKQGLVQHREGTVPAATTSFSERELSQPP-- 278

  Fly  1109 LVLLSTASSGGGGSIPATPTKETPSKGPTATLVPIGSP-KTPVSGKDT--CTTP-KSSTPATVSA 1169
                           |..|.:..|.       :.:||. :.|..|..|  |.|| .|..|   ||
  Rat   279 ---------------PLLPPQNAPH-------ITMGSHLRPPFFGMPTALCQTPGYSFLP---SA 318

  Fly  1170 SVEASSSTGEALSNGDASDRSSTPSKGATTPTSKQSNAAVQPPSSTTPNSVSGKEEPKLATCGSL 1234
            ..|..:...|.|                    .|||.|.::.........:.....|:|      
  Rat   319 QAEMLARQQELL--------------------RKQSLARLEMSELLRQKELGSVHRPQL------ 357

  Fly  1235 TSATSTSTTTTITNGIGVARTTASTAVSTASTTTTSSGTFITSCTSTTTTTTSSISNGSKDL--- 1296
               .:......|..|....:...|..|                           :.:||..|   
  Rat   358 ---LAPEVALHIPEGPDELQRRGSMLV---------------------------LKHGSAPLLAL 392

  Fly  1297 ---------PKAMIKPNVLTHVIDGFI---IQEANEPFPVTRQRYADKDVSDEPPKKKATMQEDI 1349
                     |....|.:..:....|.:   ..:.:||...||.....:|||:||.|     ..|.
  Rat   393 PPQGPPGPGPPIPAKESARSRSQKGSLGAASAQPSEPKETTRAGLWAQDVSEEPSK-----DSDG 452

  Fly  1350 KLSGIASAPGSDMVACEQCGKMEHKAKLKRKRYCSPGCSRQAKNGIGGVGSGETNGLGTGGIVGV 1414
            :...||:|.|                          |.|..::     |.:|.|...|.|     
  Rat   453 EDPEIAAARG--------------------------GASTPSQ-----VPAGGTRAEGKG----- 481

  Fly  1415 DAMALVDRLDEAMAEEKMQTEATPKLSESFPILGASTEVPPMSLPVQAAISAPSPLAMPLGSPLS 1479
                                           :|..||..||                :|||.|..
  Rat   482 -------------------------------LLSGSTLPPP----------------LPLGFPCG 499

  Fly  1480 VALPTLAPLSVVTSGAAPKSSEVNGTDRPPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQA 1544
            ...|.   ....|.|......|..|.:  .|:.|:||||.||:..|.||.:|...|.:|.|||:.
  Rat   500 AVSPY---FHTGTMGGLFTDEETTGPE--DINKWTVDDVCNFVGGLSGCGEYARVFREQGIDGET 559

  Fly  1545 LLLLKEKHLVNAMGMKLGPALKIVAKV 1571
            |.||.|:||:|.||:||||||||.|:|
  Rat   560 LPLLTEEHLLNTMGLKLGPALKIRAQV 586

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 36/65 (55%)
SAM 1511..1576 CDD:197735 35/62 (56%)
Samd11XP_008762634.1 SAM_Samd7,11 525..592 CDD:188978 36/63 (57%)
SAM 527..582 CDD:197735 32/55 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.