DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ph-p and phc2

Sequence 1:NP_476871.2 Gene:ph-p FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:NP_001106410.2 Gene:phc2 XenbaseID:XB-GENE-996998 Length:804 Species:Xenopus tropicalis

Alignment Length:902 Identity:219/903 (24%)
Similarity:337/903 (37%) Gaps:246/903 (27%)


  Fly   783 QKQQILQQQ-------QMLQQQIAAIQMQQQQAAVQAQQQQQQQVSQQQQVN------AQQQQAV 834
            |..|::||.       |.|||..||   |||...:.:...|.|.:...|||.      .....|.
 Frog    40 QTVQVIQQHRPPSTAAQYLQQMYAA---QQQHLLLHSAALQHQHIQSLQQVGLATGRPGSAPAAT 101

  Fly   835 AQQQQA-----VAQAQQQQREQQQQVAQAQAQHQQA--LANATQQILQVAPNQFITSHQQQQQQQ 892
            ..||.:     :...|...|.|....|...|..|||  |.:||...|..:          |.|..
 Frog   102 VPQQSSPHSPGINSPQSISRPQSSTPAPPSAITQQAVLLGSATSPALSAS----------QAQMY 156

  Fly   893 LHNQLI---QQQLQQQAQAQVQA---------QVQAQAQQQQQQREQQQNIIQQIVVQQSGAT-- 943
            |..|::   ........|::|.|         ||.:.|.:.|......|:.:..:..:.:.:|  
 Frog   157 LRAQMLIFTPTATVTSVQSEVSAGAPPPAGSTQVPSVAVRAQHSGLSPQSHLPSLARKPASSTLS 221

  Fly   944 SQQTSQQQQHHQSGQLQLSSVPFSVSSSTTPAGIATSSALQAALSASGAIFQTAKPGTCSSSSPT 1008
            :|..:...|...:|.|.|.|:|.:........|.:.::..:.|.|             |.:.:|.
 Frog   222 AQPVANAAQTKATGHLLLPSIPGAHLEPPDRKGESRAADGRGATS-------------CRTVAPV 273

  Fly  1009 SSVVTITNQSSTPLVTSSTVASIQQAQTQSAQVHQHQQLISATIAGGTQQQPQGPPSLTPTTNPI 1073
            ::...|....:.||:           |....|:.|||.:|          ||:....|.....|:
 Frog   274 TAHSIIAPAHTHPLI-----------QQNHKQIQQHQFVI----------QPRAALPLPQLGAPL 317

  Fly  1074 LAMTSMMNATVGHLSTAPPVTVSVTSTAVTSSPGQLVLLSTASSGGGGSIPATPTKETPSKGPTA 1138
            ...|..           |.:..|:||..|||. .||                         ||.:
 Frog   318 QPFTHQ-----------PQLCQSLTSPPVTSQ-AQL-------------------------GPPS 345

  Fly  1139 TLVPI------GSPKTPVSGKDTCTTPKSSTPATVSASVEASSSTGEALSNGDASDRSSTPSKGA 1197
            |..|.      |.||....|::....|.|||......|...::.|.:.:|:    .|:.||...:
 Frog   346 TCAPQLHSAPGGPPKISPEGQERRLLPHSSTVILQLHSPPGTTPTPQDVSH----KRTFTPLGNS 406

  Fly  1198 ---------TTPTSKQSNAAVQPPSSTTPNSVSGKEEPKLATCGSLTSATSTSTTTTITNGIGVA 1253
                     |.|.:::|          .|...|..|...|..|.............||.:.:.:.
 Frog   407 PCLLHLHPPTAPLAQES----------APGGASVTETSDLCQCQPDDPRPPALPDPTIPSALDMT 461

  Fly  1254 RTTASTAVSTASTTTTSSGTFITSCTSTTTTTTSSISNGSKDLPKAMIKPNVLTHVIDGFIIQEA 1318
            ....|..|.|.:                   |.:|..||....|:|:::|.:|||||:||:|||.
 Frog   462 SGNGSAPVPTVA-------------------TGNSAQNGENKPPQAVVRPQILTHVIEGFVIQEG 507

  Fly  1319 NEPFPVTR-----------------QRYADKDVSDEPPKKKA--------TMQEDIKLSGIASAP 1358
            .:|||..|                 :||....::::.|::.:        :..|:..:.|...:.
 Frog   508 AQPFPSHRSRAAPEVGRSSLLIGAHERYPQGLLAEKVPQQDSNTTTTTTDSEMEETFVPGFPDSK 572

  Fly  1359 GS---DMVACEQCGKMEHKAKLKR-KRYCSPGCSRQAKNGIGGVGSGETNGLGTGGIVGVDAMAL 1419
            |.   ..:.||.||:::.:.|.|| ||:||..|:::.     .||..:..||             
 Frog   573 GDGDPPKLKCELCGRVDFEYKFKRSKRFCSMACAKRY-----NVGCTKRVGL------------- 619

  Fly  1420 VDRLDEAMAEEKMQTEATPKLSESFPILGASTEVPPMSLPVQAAISAPSPLAMPLG--------- 1475
             ...|.:..::....:...:.::..|:...||: |...:|..|...||.|:..|..         
 Frog   620 -FHPDRSKLQKPTGAKHARRRAQKGPLQSVSTD-PKKQVPASAPPIAPGPVPAPSALKHSNSQED 682

  Fly  1476 ----SPLSVALPTLAPLSVVTSGAAPKSSEVNGTDRPPISS-----------------WSVDDVS 1519
                |..|.....|:|||..:|.:.|: .|.|....||:.|                 |:|:||.
 Frog   683 SSRCSDNSSYEEPLSPLSASSSLSRPR-PERNLEAPPPLHSRDHIALNQDFLPSNPTKWNVEDVY 746

  Fly  1520 NFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHLVNAMGMKLGPALKIVAKVESIKE 1576
            .|||.||||||..::|..|||||||||||||.||::||.:|||||||:.|::..:|:
 Frog   747 EFIRSLPGCQDISEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKLYARISMLKD 803

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 43/85 (51%)
SAM 1511..1576 CDD:197735 41/82 (50%)
phc2NP_001106410.2 PHC2_SAM_assoc 610..734 CDD:293222 28/140 (20%)
SAM_Ph1,2,3 735..803 CDD:188976 40/68 (59%)
SAM 737..804 CDD:197735 40/68 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JS2
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.860

Return to query results.
Submit another query.