DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4045 and trm8

Sequence 1:NP_569978.1 Gene:CG4045 FlyBaseID:FBgn0025629 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_588028.1 Gene:trm8 PomBaseID:SPCPB16A4.04c Length:273 Species:Schizosaccharomyces pombe

Alignment Length:270 Identity:129/271 (48%)
Similarity:170/271 (63%) Gaps:15/271 (6%)


  Fly     1 MVATGGQAQDQGQNQEPDV------LNPTSAVTG-LPQKRYYRQRAHSNPIADHSFDYPARPEDV 58
            |.||..::..|.|.:|.:.      |:....|.| ||.||.:|||||:|.::||..:||..|.::
pombe     1 MSATAKKSAAQLQREEEEARKKLKRLSKQGGVEGRLPMKRLFRQRAHANVLSDHELEYPRSPSEM 65

  Fly    59 DWRSMYP--GIQQGQQVSFADIGCGYGGFLVTLGEMFPEKLSIGMEIRVKVSDYVVDRIAALRRR 121
            ||...||  .::..::|...||||||||..|.||..||:.|.:|||||::||||:.::|.|||.|
pombe    66 DWSPYYPDFDVESNKKVEIVDIGCGYGGLTVALGPQFPDTLVLGMEIRMQVSDYLKEKIQALRYR 130

  Fly   122 CAD-----TGAYQNIACLRTNAMKYLPNYFVKGQLEKMFFLYPDPHFKRAKHKWRIINQALLSEY 181
             ||     .|.|:||:.||.|..|:|||:|.||||.||||.:||||||..|||.|||...|.|||
pombe   131 -ADHEEPVPGGYKNISVLRMNCQKFLPNFFEKGQLSKMFFCFPDPHFKARKHKNRIITSTLASEY 194

  Fly   182 AYILRKGGLLYTMTDVEDLHKWIVTHMEEHPLYERLTEEEANADPITPKLYQSSEEGAKVVRNKG 246
            ||.:|..|.|||:||||:||.|:..|::.|||:.|.|:||...|.....:...:|||.||.||.|
pombe   195 AYFIRPHGTLYTITDVEELHVWMAQHLDAHPLFRRFTKEEEENDICVTLMTNETEEGKKVARNGG 259

  Fly   247 DHFLAIFRRL 256
            ..|:|.:.|:
pombe   260 KKFVACYERI 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4045NP_569978.1 Methyltransf_4 71..251 CDD:280538 99/185 (54%)
trm8NP_588028.1 TrmB 31..272 CDD:223298 122/241 (51%)
Methyltransf_4 80..264 CDD:280538 99/185 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H3918
Inparanoid 1 1.050 252 1.000 Inparanoid score I766
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004241
OrthoInspector 1 1.000 T1124384
orthoMCL 1 0.900 OOG5_127179
Panther 1 1.100 LDO PTHR23417
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1553
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.