DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4045 and W02B12.10

Sequence 1:NP_569978.1 Gene:CG4045 FlyBaseID:FBgn0025629 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_496448.1 Gene:W02B12.10 WormBaseID:WBGene00012205 Length:256 Species:Caenorhabditis elegans

Alignment Length:236 Identity:149/237 (63%)
Similarity:182/237 (77%) Gaps:1/237 (0%)


  Fly    22 PT-SAVTGLPQKRYYRQRAHSNPIADHSFDYPARPEDVDWRSMYPGIQQGQQVSFADIGCGYGGF 85
            || ..|.|||||::|||||||||.:||..:||..|..:||...|....:|:||.||||||||||.
 Worm    16 PTCETVPGLPQKKHYRQRAHSNPHSDHDIEYPLTPNHMDWTKYYGDYTKGRQVDFADIGCGYGGL 80

  Fly    86 LVTLGEMFPEKLSIGMEIRVKVSDYVVDRIAALRRRCADTGAYQNIACLRTNAMKYLPNYFVKGQ 150
            |:.|...:|:.|.|||||||||||||.::|.|||:..|:.|.|:|:|.||:|||||:||||.|||
 Worm    81 LMRLSPKYPDNLMIGMEIRVKVSDYVNEKIQALRKHHAEAGHYRNVAVLRSNAMKYMPNYFHKGQ 145

  Fly   151 LEKMFFLYPDPHFKRAKHKWRIINQALLSEYAYILRKGGLLYTMTDVEDLHKWIVTHMEEHPLYE 215
            |.|||||:||||||..|||||||...|||||||:||:||::||:|||:|||:|:|.|:.||||:|
 Worm   146 LSKMFFLFPDPHFKNKKHKWRIITPTLLSEYAYVLREGGIIYTITDVKDLHEWMVKHLSEHPLFE 210

  Fly   216 RLTEEEANADPITPKLYQSSEEGAKVVRNKGDHFLAIFRRL 256
            ||||||...|||...|::|:|||.||.||.|..:.||||||
 Worm   211 RLTEEEMKKDPIVEMLFESTEEGQKVTRNDGGKWPAIFRRL 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4045NP_569978.1 Methyltransf_4 71..251 CDD:280538 117/180 (65%)
W02B12.10NP_496448.1 TrmB 30..253 CDD:223298 141/223 (63%)
Methyltransf_4 66..246 CDD:280538 117/180 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C293292065
eggNOG 1 0.900 E1_COG0220
Hieranoid 1 1.000
Homologene 1 1.000 H3918
Inparanoid 1 1.050 321 1.000 Inparanoid score I1470
Isobase 1 0.950 0 Normalized mean entropy S384
OMA 1 1.010
OrthoDB 1 1.010 D1417652at2759
OrthoFinder 1 1.000 FOG0004241
OrthoInspector 1 1.000 T477261
orthoMCL 1 0.900 OOG5_127179
Panther 1 1.100 LDO PTHR23417
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1553
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.