DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtca and RTCA

DIOPT Version :8

Sequence 1:NP_001284801.1 Gene:Rtca / 31175 FlyBaseID:FBgn0025630 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001124313.1 Gene:RTCA / 8634 HGNCID:17981 Length:379 Species:Homo sapiens

Alignment Length:374 Identity:140/375 (37%)
Similarity:216/375 (58%) Gaps:25/375 (7%)


  Fly     7 LEIDGSYLEGGGQALRNALSLSCILGKPVRVVKIRASRPSPGLSH-------------QHLHGLN 58
            :|:|||.:|||||.||.:.:|||:||.|:||.||||.|.:||||.             |||.||.
Human     6 VEVDGSIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLSSGGWKSKIKVLTRPQHLSGLE 70

  Fly    59 LLRDITNADVVGNYLLSSTVEFTPRTILDNTYRVETHTAASITLIYQMALPVLLFAGRPSRLIVS 123
            ::||:.:..:.|..:.|:.:.|||..|....:..:|.||.|:.|:.|:::|.:|||..||.|.:.
Human    71 MIRDLCDGQLEGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSELHLK 135

  Fly   124 GGTNVDFAPPVEYMQEVLLPNLKHFGVSFDLKVQRYGFYPRGQGRCQLDVQPVTKLNSGKLVAFG 188
            ||||.:.||.::|...|..|.::.||..|:..::..|:||:|.|...:.:.||.:||...|...|
Human   136 GGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERG 200

  Fly   189 RIKSVSGVAYCAGRLPVNIAIDMQQTAQREIHRLWPSQQCSIEPIKHSRQKAFHNGAGILMTVNT 253
            .:..:.|.|:.||.||..:|.||...|.|.|.:.......:|:|::..:.:||.||.||::...|
Human   201 CVTKIYGRAFVAGVLPFKVAKDMAAAAVRCIRKEIRDLYVNIQPVQEPKDQAFGNGNGIIIIAET 265

  Fly   254 TSDVVLGASALGKKRIDGHVLGSEASCQLGDYMRKQVCVDDYMQDQLIIYMALAVGRSTMRTGKL 318
            ::..:...|:|||:.::...:|.||:..|...:|....||:|:|||||::||||.|.|.::||.:
Human   266 STGCLFAGSSLGKRGVNADKVGIEAAEMLLANLRHGGTVDEYLQDQLIVFMALANGVSRIKTGPV 330

  Fly   319 TNHTRTAINVAEQMTGVKF---------DVAMEPGGQMLVSCKGLGHVN 358
            |.||:|||:.|||:...||         |.|.:   ..::.|:|:|..|
Human   331 TLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKD---TYIIECQGIGMTN 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RtcaNP_001284801.1 RNA_3prim_cycl 7..338 CDD:274563 134/353 (38%)
RNA_Cyclase_Class_II 9..341 CDD:238446 135/354 (38%)
RTCANP_001124313.1 RNA_3prim_cycl 6..350 CDD:274563 134/344 (39%)
RNA_Cyclase_Class_II 8..353 CDD:238446 133/345 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C269895106
eggNOG 1 0.900 E1_COG0430
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2766
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1151685at2759
OrthoFinder 1 1.000 FOG0007761
OrthoInspector 1 1.000 T1072521
orthoMCL 1 0.900 OOG5_129746
Panther 1 1.100 LDO PTHR11096
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R11072
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.750

Return to query results.
Submit another query.