DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtca and RCL1

DIOPT Version :8

Sequence 1:NP_001284801.1 Gene:Rtca / 31175 FlyBaseID:FBgn0025630 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_014633.1 Gene:RCL1 / 854152 SGDID:S000005370 Length:367 Species:Saccharomyces cerevisiae

Alignment Length:374 Identity:88/374 - (23%)
Similarity:154/374 - (41%) Gaps:57/374 - (15%)


  Fly    17 GGQALRNALSLSCILGKPVRVVKIRASRPSPGLSHQHLHGLNLLRDITNADVVGNYLLSSTVEFT 81
            |.|..|..:.|:.:.|||:::.|||:...:|||....:..|.|:..:||..|:......:||.:.
Yeast    13 GSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVTNGSVIEISYTGTTVIYR 77

  Fly    82 PRTILDNTYRVETHTAASITLIYQMALPVLL---FAGRPSRLIVSGGTNVDFAPPVEYMQEVLLP 143
            |..|:..   ..||...|...:.....|:|.   |:.:...::..|.|.......:|.::..|:|
Yeast    78 PGIIVGG---ASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKGITASHNDAGIEAIKWGLMP 139

  Fly   144 NLKHFGV-SFDLKVQRYGFYPRGQGRCQLDV-----QPVTKLNSGKLVAFGRIKSVSGVAYCAGR 202
            .::.||| ...|...:.|..|.|.|...|.|     ||:|.....:.:    |.|::||||....
Yeast   140 VMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHEIDRPI----ISSITGVAYSTRV 200

  Fly   203 LP--VNIAID----MQQTAQREIH---RLWPSQQCSIEP------IKHSRQKAFHNGAGILMTVN 252
            .|  ||..||    :.:..|.|::   .:|..:.....|      :..|:||.:          :
Yeast   201 SPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPGWGITLVAQSKQKGW----------S 255

  Fly   253 TTSDVVLGASALGKKRIDGHVLGSEASCQLGDYMRKQVCVDDYMQDQLIIYMALA---VGRSTMR 314
            ..::.:..|.::.::      ||.:.:|||.:.:.|...|........|:||.:.   :||  :|
Yeast   256 YFAEDIGDAGSIPEE------LGEKVACQLLEEISKSAAVGRNQLPLAIVYMVIGKEDIGR--LR 312

  Fly   315 TGKLTNHTRTAINVAEQMTGVKFDVAMEP-----GGQMLVSCKGLGHVN 358
            ..|.....|..|.:.:.......:|.::|     ...|:.:.||:|..|
Yeast   313 INKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFTN 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RtcaNP_001284801.1 RNA_3prim_cycl 7..338 CDD:274563 81/347 (23%)
RNA_Cyclase_Class_II 9..341 CDD:238446 82/350 (23%)
RCL1NP_014633.1 18S_RNA_Rcl1p 10..367 CDD:274564 88/374 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C269958085
eggNOG 1 0.900 E1_COG0430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.