DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtca and Rcl1

DIOPT Version :8

Sequence 1:NP_001284801.1 Gene:Rtca / 31175 FlyBaseID:FBgn0025630 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_067500.1 Gene:Rcl1 / 59028 MGIID:1913275 Length:373 Species:Mus musculus

Alignment Length:367 Identity:97/368 (26%)
Similarity:161/368 (44%) Gaps:28/368 (8%)


  Fly    12 SYLEGGGQALRNALSLSCILGKPVRVVKIRASRPSPGLSHQHLHGLNLLRDITNADVVGNYLLSS 76
            ||  .|...||..|.||.:.|:||::.:|||...:|||.......:.||..|||...:......:
Mouse     9 SY--AGCNFLRQRLVLSTLSGRPVKIRRIRARDDNPGLRDFEASFIRLLDKITNGSRIEINQTGT 71

  Fly    77 TVEFTPRTILDNTYRVETHTAASITLIYQMALPVLLFAGRPSRLIVSGGTNVDFAPPVEYMQEVL 141
            |:.:.|..:...:...:......|....:..|.:..|...|.::::.|.||....|.|:.::...
Mouse    72 TLYYQPGLLYGGSVEHDCSVLRGIGYYLEALLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATA 136

  Fly   142 LPNLKHFGV---SFDLKVQRYGFYPRGQGRCQLDVQPVTK-LNSGKLVAFGRIKSVSGVAYCAGR 202
            ||.||.||:   ||:||:.|.|..|.|.|...... ||.| |...:|...|:||.:.|:||.. |
Mouse   137 LPLLKQFGIDGESFELKILRRGMPPGGGGEVLFSC-PVRKVLKPVQLTDPGKIKRIRGMAYSV-R 199

  Fly   203 LPVNIAIDMQQTAQREIHRLWPSQQCSIEPIKH-SRQKAFHNGAGILMTVNTTSDVVLGASALGK 266
            :...:|..:..:|:..:::..|......:.:|. |..|:  .|.|:.:...||:...|.|.....
Mouse   200 VSPQMANRIVDSARSILNKFIPDIYIYTDHMKGVSSGKS--PGFGLSLVAETTNGTFLSAELASN 262

  Fly   267 KRIDGHV-----LGSEASCQLGDYMRKQVCVDDYMQDQLIIYMALAVGR---STMRTGKLTNHTR 323
            .:..|..     ||...:..|.:.:.:..|||...|..:::.|.|  |:   |.:..|.|:.:|.
Mouse   263 PQGQGAAVLPEDLGRNCAKLLLEEIYRGGCVDSTNQSLVLLLMTL--GQQDVSKVLLGPLSPYTI 325

  Fly   324 TAINVAEQMTGVKFDVAMEP-------GGQMLVSCKGLGHVN 358
            ..:...:....|.|.|..:|       |.::|::|.|:|..|
Mouse   326 EFLRHLKSFFQVMFKVETKPCGEELKGGDKVLMTCVGIGFSN 367

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RtcaNP_001284801.1 RNA_3prim_cycl 7..338 CDD:274563 89/339 (26%)
RNA_Cyclase_Class_II 9..341 CDD:238446 90/342 (26%)
Rcl1NP_067500.1 RNA_Cyclase_Class_I 4..343 CDD:238447 90/342 (26%)
18S_RNA_Rcl1p 8..371 CDD:274564 97/368 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.