DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtca and rtca

DIOPT Version :8

Sequence 1:NP_001284801.1 Gene:Rtca / 31175 FlyBaseID:FBgn0025630 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_955830.1 Gene:rtca / 321129 ZFINID:ZDB-GENE-030131-9687 Length:363 Species:Danio rerio

Alignment Length:360 Identity:147/361 (41%)
Similarity:214/361 (59%) Gaps:5/361 (1%)


  Fly     3 AEKMLEIDGSYLEGGGQALRNALSLSCILGKPVRVVKIRASRPSPGLSHQHLHGLNLLRDITNAD 67
            |....|:|||.:|||||.||.:.:||||.|..:::.||||.|.:|||..|||.||.||||:.|.:
Zfish     2 AATTFEMDGSVMEGGGQILRVSAALSCIQGASIKINKIRAGRSTPGLRPQHLSGLELLRDMCNGN 66

  Fly    68 VVGNYLLSSTVEFTPRTILDNTYRVETHTAASITLIYQMALPVLLFAGRPSRLIVSGGTNVDFAP 132
            :.|..:.||.:..||..|....:..:||||.|:||:.|::||..|||..||.|.:.||||.:.||
Zfish    67 LEGATVGSSEITLTPGKIKGGNHIADTHTAGSVTLLMQVSLPCALFAQGPSELCLKGGTNAEMAP 131

  Fly   133 PVEYMQEVLLPNLKHFGVSFDLKVQRYGFYPRGQGRCQLDVQPVTKLNSGKLVAFGRIKSVSGVA 197
            .::|..:|..|.::.|||.||..::..|:||:|.|...|.|.|..:|:...:...|.|..:.|.|
Zfish   132 QIDYTVKVFKPIVERFGVQFDCDLRMRGYYPKGGGEVVLKVNPAKELSPINMTERGNITKIYGRA 196

  Fly   198 YCAGRLPVNIAIDMQQTAQREIHRLWPSQQCSIEPIKHSRQKAFHNGAGILMTVNTTSDVVLGAS 262
            :.||.||..:|.||...|.|.|.:.......:|:.:: .:.||..||.||::...:::..:...|
Zfish   197 FVAGVLPFKLAKDMSTAAIRTIRKEIKDLYINIQSLQ-EKDKACGNGNGIIIIAESSTGCIFAGS 260

  Fly   263 ALGKKRIDGHVLGSEASCQLGDYMRKQVCVDDYMQDQLIIYMALAVGRSTMRTGKLTNHTRTAIN 327
            :||||.:....:|.||:..|...:|...|||:::||||||:||||.|.|.||||.:|.||:|||:
Zfish   261 SLGKKGVYADKVGIEAAEMLLRNIRHNGCVDEFLQDQLIIFMALANGTSRMRTGPITLHTQTAIH 325

  Fly   328 VAEQMTGVKFDVAM----EPGGQMLVSCKGLGHVN 358
            ||||:|..||.::.    ......::.|:|:|..|
Zfish   326 VAEQLTNAKFAISKAEDENANDTYIIECQGVGATN 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RtcaNP_001284801.1 RNA_3prim_cycl 7..338 CDD:274563 142/331 (43%)
RNA_Cyclase_Class_II 9..341 CDD:238446 141/332 (42%)
rtcaNP_955830.1 RNA_Cyclase_Class_II 8..339 CDD:238446 141/332 (42%)
RTC 12..337 CDD:279479 138/326 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C269897054
eggNOG 1 0.900 E1_COG0430
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2766
Inparanoid 1 1.050 268 1.000 Inparanoid score I2949
OMA 1 1.010
OrthoDB 1 1.010 D1151685at2759
OrthoFinder 1 1.000 FOG0007761
OrthoInspector 1 1.000 T1051941
orthoMCL 1 0.900 OOG5_129746
Panther 1 1.100 LDO PTHR11096
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R11072
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.